[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55614.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c1yA.bssp"
#ERROR : Can't open dsspfile "2bgwA.bssp"

## Summary of PDB Search
:226
    1e-05  16%  3c1yA  [x.x.x] DNA INTEGRITY SCANNING PROTEIN DISA
    3e-04  17%  2bgwA  [x.x.x] XPF ENDONUCLEASE
:226

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
3c1yA           -----RVLGYDVQQAAQLDDVLVSARGYRLLKTVARIPLS------IGYNVVRMFKTLDQISKASVEDLK
2bgwA           ---------------RIVIHKKPRLSDVREWQLYILQSFPGIGRR-TAERILERFGSLERFFTASKAEIS


                         .         .         *         .         .         .         .:140
query           SLSGIGRVKAIELQAMIELGHRIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c1yA           KVEGIGEKRARAISESISSLKHR-----------------------------------------------
2bgwA           KVEGIGEKRAEEIKKILMTPYK------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c1yA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxx
3c1yA           ----------------
2bgwA           ----------------