[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55668.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dqsA.bssp"
#ERROR : Can't open dsspfile "3ce9A.bssp"
#ERROR : Can't open dsspfile "3ce9B.bssp"
#ERROR : Can't open dsspfile "1dqsB.bssp"
#ERROR : Can't open dsspfile "2d2xB.bssp"
#ERROR : Can't open dsspfile "2bi4A.bssp"
#ERROR : Can't open dsspfile "3clhA.bssp"
#ERROR : Can't open dsspfile "3bfjA.bssp"
#ERROR : Can't open dsspfile "2d2xA.bssp"
#ERROR : Can't open dsspfile "2b98C.bssp"
#ERROR : Can't open dsspfile "2b98B.bssp"
#ERROR : Can't open dsspfile "1cb2A.bssp"
#ERROR : Can't open dsspfile "2b99B.bssp"

## Summary of PDB Search
:362
    2e-41  16%  1dqsA  [e.22.1] PROTEIN (3-DEHYDROQUINATE SYNTHASE)
    8e-38  16%  3ce9A  [x.x.x] GLYCEROL DEHYDROGENASE
    3e-37  16%  3ce9B  [x.x.x] GLYCEROL DEHYDROGENASE
    2e-35  13%  1dqsB  [e.22.1] PROTEIN (3-DEHYDROQUINATE SYNTHASE)
    5e-34  16%  2d2xB  [x.x.x] 2-DEOXY-SCYLLO-INOSOSE SYNTHASE
    8e-34  18%  2bi4A  [x.x.x] LACTALDEHYDE REDUCTASE
    2e-33  16%  3clhA  [x.x.x] 3-DEHYDROQUINATE SYNTHASE
    2e-33  21%  3bfjA  [x.x.x] 1,3-PROPANEDIOL OXIDOREDUCTASE
    3e-32  17%  2d2xA  [x.x.x] 2-DEOXY-SCYLLO-INOSOSE SYNTHASE
    2e-12  12%  2b98C  [x.x.x] RIBOFLAVIN SYNTHASE
    6e-09  13%  2b98B  [x.x.x] RIBOFLAVIN SYNTHASE
    1e-07   9%  1cb2A  [c.6.1] CELLOBIOHYDROLASE II
    4e-05  12%  2b99B  [x.x.x] RIBOFLAVIN SYNTHASE
:362

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGKRFEDYLHRYGFHIVLALFNGEASDN
1dqsA           -ISILGRESIIADFGLWRNYVAKDLISSTTYVLVTDTNIGSIYTPSFEEAFRKRALIYNRPPGEVSKSRQ
3ce9A           ---IAIPLILEVGNNKIYNIGQIIKKGNFKRVSLFGEGIYELFGETIEKSIKSSNIEIEAVETVKNIDFD
3ce9B           ---IAIPLILEVGNNKIYNIGQIIKKGNFKRVSLFGEGIYELFGETIEKSIKSSNIEIEAVETVKNIDFD
1dqsB           ---ILGRESIIADFGLWRNYVAKDLISSTTYVLVTDTNIGSIYTPSFEEAFRKRAAEITPS---PRLLIY
2d2xB           ICFADRCFNFAFGEHVLESVESYIPRDEFDQYIMSDSGVPDSIVHYAAEYFGKLAPVHILRFQGGEETLS
2bi4A           --RMILNETAWFGRGAVGALTDEVKRRGYQKALIVKTLVQCGVVAKVTDKMDAAGLAWAIDGVVPNPTIT
3clhA           ------------KEKNYKVFLGELPELKQKALIISDSIVAGLHLPYLLERLKALEVRCVIESGEKYKNFH
3bfjA           MFDYLVPNVNFFGPNAISVVGERCQLLGGKKALLVKGLRKDGAVDKTLHYLREAGIEVIFDGVEPNPKDT
2d2xA           ICFADRCFNFAFGEHVLESVESYIPRDEFDQYIMSDSGVPDSIVHYAAEYFGKLAPVHILRFQGGEETLS
2b98C           --------------------------------IVDTTFARVDMASIAIKKLKELSPNIKIIRKTVPGIKD
2b98B           ------------------------------KVGIVDTFARVDMASIAIKKLKELSPNIKIIRKTVPGIKD
1cb2A           ----------------------------------------------------------------------
2b99B           -----------------------------------TTFARVDMASIAIKKLKELSPNIKIIRKTVPGIKD


                         .         .         *         .         .         .         .:140
query           EINRVVALAEKENCDSIIGLGGGKTIDSAKAIADLIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYL
1dqsA           TKADIEDWMLSQNPTVVIALGGGVIGDLTGFVASTYMRRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLI
3ce9A           EIGTNAF-KIPAEVDALIGIGGGKAIDAVKYAFLRK-LPFISVPTSTSNDGFSSPVASLLINGKRTSVPA
3ce9B           EIGTNAF-KIPAEVDALIGIGGGKAIDAVKYAFLR-KLPFISVPTSTSNDGFSSPVASLLINGKRTSVPA
1dqsB           NRPPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLI
2d2xB           TVTNLQERAIALGRTAIVAVGGGLTGNVAGVAAGMMFRALIHVPTTAASDSVLSIKQAVNLTSGKNLVGF
2bi4A           VVKEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIISNVPILAIPTTAGTAAEVTINYVITDEEKRRKFVC
3clhA           SLERILNNAFEMQLSLMIALGGGVISDMVGFASSIYFRDFINIPTTLLAQVDASVGGKTGINTPYGKNLI
3bfjA           NVRDGLAVFRREQCDIIVTVGGGSPHDCGKGIGIAATPPIVAVNTTAGTASEVTRHCVLTNTETKVKFVI
2d2xA           TVTNLQERAIALGATAIVAVGGGLTGNVAGVAAGMMFRGIVPTTFLAASDSVLSIKQAVNLTSGKNLVGF
2b98C           LPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDKELDWL
2b98B           LPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLHIIEVFVHEDEAKDDKELDWLAKRRAEEHAEN
1cb2A           ----------------------------------------------------------------------
2b99B           LPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQL--MTNKHIIEVFVHEEAKDDKELDW


                         +         .         .         .         .         *         .:210
query           FYSKNPDLVLVDTKVISQAPKRLLASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLF
1dqsA           GAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSTALEENAETILKAVRRRF------EGTEEIL
3ce9A           KT---PDGIVVDIDVIKGSPEKFIYSGIGDLVSNITALY------DWKFEEENHKSIIDDFAVISKKSVN
3ce9B           KT---PDGIVVDIDVIKGSPEKFIYSGIGDLVSNITALYD------WKFEEENHKSIIDDFAVISKKSVN
1dqsB           GAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSTALEENAET------ILKAVRRTEEILKARI
2d2xB           YY--PPRFVFADTRILSESPPRQVKAGMCELVKNMLILENDNKE-----FTEDDLNSANVYSPKQLETFI
2bi4A           VDPHDPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTD----------ALHIKAIEIIA
3clhA           GSFHQPKAVYMDLAFLKTLEKREFQAGVAEIIKMAVCFDK------------------------------
3bfjA           VSWRNPSVSINDPLLMIGKPAALTAATGMDALTHAVEAYISKDANPVTD----------AAAMQAIRLIA
2d2xA           YY--PPRFVFADTRILSESPPRQVKAGMCELVKNMLILKEFTEDDLNSA------------NVYSPKQLE
2b98C           AKRRAEEHAENKPEYLTRMAGKGLRQGFED----------------------------------------
2b98B           VY--------------------------------------------------------------------
1cb2A           -----GQFVVFDLPDRDCAALASEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVI-------EPDSL
2b99B           AKRRAEEHAENVYYLLFEYLTRMAGKGL------------------------------------------


                         .         .         .         +         .         .         .:280
query           ADGLQAMAACEAKVVTPALENIVEANTXXXXXXXXXXXXXXXHAIHNGFTALTGDIHHLTHGEKVAYGTL
1dqsA           KARILASARHKAYVVS-ADEREGGLRN----------LLNWGHSIGHAIEAILT--PQILHGECVAIGMV
3ce9A           SF---VRTDFKSIKDEVFLKELVDSLTIAEIAGNSSPASGAEHLISHALDKFLP--NPQLHGIQVGVATY
3ce9B           S---FVRTDFKSIKDEVFLKELVDSLTIAEIAGNSSPASGAEHLISHALDKFLP--NPQLHGIQVGVATY
1dqsB           LASARHKAYVVSADEREGGLRNLLNWG---------------HSIGHAIEAILT--PQILHGECVAIGMV
2d2xB           NFCISAKMSVLSEDIYEKKKGLIFE---------------YGHTIGHAIELAEQ--GGITHGEAIAVGMI
2bi4A           GALRGSVAGDKD-----AGEEMALG-QYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVATGEKYRDVKV
3clhA           ----NLVERLETKDLKDCLEEVIFQSV-NIKAQVVRAGLNYGHTFGHAIEKE-TDYERFLHGEAIAIGMR
3bfjA           RNLRQAVALGSNLQA----REYMAYASLLAGMAFNNANLGYVHAMAHQLGGLYDMPHGVAIANPEKFADI
2d2xA           TFINFCISAKMSVLSEDIYE------------KKKGLIFEYGHTIGHAIELAEQ--GGITHGEAIAVGMI
2b98C           ----------------------------------------------------------------------
2b98B           ----------------------------------------------------------------------
1cb2A           ANLVTNLGTPKCANAQSAYLECINY------------AVTQLNLPNVAMYLDAG-HAGWLGWPANQDPAA
2b99B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VQLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMPFKISPSDVAQ
1dqsA           KEAELARHLGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSVDQLMALDKKNDGPKKKIVLLSAIGT
3ce9A           ISKVHKHRE----ERIKKILSDTGFFNYVKGLNKKS---DFKRAISEAHLIKPARYTYLHVEKNCETAKE
3ce9B           ISKVHK----HREERIKKILSDTGFFNYVKGLNKKS---DFKRAISEAHLIKPARYTYLHVEKNCETAKE
1dqsB           KEAELARHLGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSVDQLMALDKKNDGPKKKIVLLSAIGT
2d2xB           YAAKIANRPEHDVSAHYWLLNKIGALQDIDPDSIFHYLIEDNLGMILLSGVGKPAMYNQTLLTPVRKTLI
2bi4A           EGMSLEEARNAAVEAVFALNRDVGIPPHLRDVGVRK---EDIPALAQAALDDVCTGG-NPREATLEDIVE
3clhA           MANDLALSTLKEYERIENLLKKFDLIFHYKFILPKGVGAFEVAS--------------------------
3bfjA           AELMGENAAEKAIAAITRLSMDIGIPQHLRDLGVKE---TDFPYMAEMALKDGNAFS-NPRKGNEQEIAA
2d2xA           YAAKIANRPEHDVSAHYWLLNKIGALQDIPLKSDPDSIFHYLIHEDNLGMILLSGVGKMYNQTLLTPVRK
2b98C           ----------------------------------------------------------------------
2b98B           ----------------------------------------------------------------------
1cb2A           QLFVYKNASSPRALRGLATNVANYNGWTQGNAVYNEKLYIHAIG--------------------------
2b99B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AIIAVDAYVxxx
1dqsA           PYET--------
3ce9A           IVDTDE------
3ce9B           IV----------
1dqsB           PYETRASVV---
2d2xB           KEVIREG-----
2bi4A           LYHT--------
3clhA           ------------
3bfjA           IFRQ--------
2d2xA           TLIK--------
2b98C           ------------
2b98B           ------------
1cb2A           ------------
2b99B           ------------