[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55740.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1eh1A.bssp"
#ERROR : Can't open dsspfile "1dd5A.bssp"
#ERROR : Can't open dsspfile "1ek8A.bssp"
#ERROR : Can't open dsspfile "1ay5B.bssp"

## Summary of PDB Search
:185
    4e-60  44%  1eh1A  [d.67.3] RIBOSOME RECYCLING FACTOR
    4e-59  43%  1dd5A  [d.67.3] RIBOSOME RECYCLING FACTOR
    3e-57  46%  1ek8A  [d.67.3] RIBOSOME RECYCLING FACTOR
    7e-04  16%  1ay5B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
:185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
1eh1A           ----LYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQSW
1dd5A           ----FIKEAKEKMKRTLEKIEDELRKMRTGKPSPAILEEIKVDYYGVPTPVNQLATISISEERTLVIKPW
1ek8A           MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
1ay5B           --------------------------MAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMF-SR


                         .         .         *         .         .         .         .:140
query           DKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
1eh1A           DQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVAIRNIRREALDKLK
1dd5A           DKSVLSLIEKAINASDLGLNPINDGNVIRLVFPSPTTEQREKWVKKAKEIVEEGKIAIRNIRREILKKIK
1ek8A           DRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVK
1ay5B           LGATPEQVKRIKEEFGIYMVGD-----SRINIAGLNDNTIPILARAIIEVG-------------------


                         +         .         .         .         .         *         .:210
query           KQEKAKEITEDELKTLEKDIQKVTDDAVKHIDDMTANKEKELLEx
1eh1A           KLAKELHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEIL--
1dd5A           EDQKEGLIPEDDAKRLENEIQKLTDEFIEKLDEVFEIKKEEIME-
1ek8A           ALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQ-
1ay5B           ---------------------------------------------