[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55766.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bu8A.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "2bu7A.bssp"
#ERROR : Can't open dsspfile "3d2rB.bssp"
#ERROR : Can't open dsspfile "1b63A.bssp"
#ERROR : Can't open dsspfile "3d36B.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "2c2aA.bssp"
#ERROR : Can't open dsspfile "3ehjA.bssp"
#ERROR : Can't open dsspfile "2bu6A.bssp"
#ERROR : Can't open dsspfile "2akpA.bssp"
#ERROR : Can't open dsspfile "2dvyB.bssp"
#ERROR : Can't open dsspfile "1b62A.bssp"
#ERROR : Can't open dsspfile "3crlA.bssp"

## Summary of PDB Search
:532
    1e-08  12%  2bu8A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    5e-08  14%  1bxdA  [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    8e-07  12%  2bu7A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    2e-06   8%  3d2rB  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    7e-06  15%  1b63A  [d.122.1 - d.14.1] MUTL
    1e-05  15%  3d36B  [x.x.x] SPORULATION KINASE B
    6e-05  14%  1aj6A  [x.x.x] GYRASE
    1e-04  20%  2c2aA  [x.x.x] SENSOR HISTIDINE KINASE
    1e-04  13%  3ehjA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    1e-04  13%  2bu6A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    4e-04   8%  2akpA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    8e-04  11%  2dvyB  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    8e-04  15%  1b62A  [d.122.1 - d.14.1] PROTEIN (MUTL)
    8e-04  14%  3crlA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
:532

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bu8A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bu8A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bu8A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLYLTLRQTFANYQKQVVDLVESIQVIAQGEXG
2bu8A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu7A           ------------------------------------------------------------------LSTP
3d2rB           --------------------------------------ERTSFAFLRQELPVRLANILKEIDILPTQLVN
1b63A           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------RVLSTP
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RRIDISEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNTLEFLRMYAVM
2bu8A           DHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTL
1bxdA           ----------------------------------------------------------------------
2bu7A           SVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDARHNDVVPTMAQGVLEYKDTYGDDPVSLDRFYLSR
3d2rB           T-SSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKACTVDPVT
1b63A           ----------------------------------------------------------------------
3d36B           ----------------HMVIRAEKHLAASISH----EIRNPLTAARGFIQLIEEQPLAADKRRQYARIAI
1aj6A           ----------------------------------------------------------------------
2c2aA           ---NVTE--SKELERLKRIDRMKTEFIANISH----ELRTPLTAIKAIYNSLGELDLSTLKEFLVIIDQS
3ehjA           ------------------------KLEDANERIAELVKLEERQRARDLVDTLGQKLSLGLKSDLARKLIY
2bu6A           SVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDARHNDVVPTMAQGVLEYKDTYGDDPVYFLRFYLSR
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           QSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPKSIAYGFKIDPELENMKIPKFT
2bu8A           IFDGSTNPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSH
1bxdA           -----------------------------------------------GYEREIETALYPGSIEVKMHPLS
2bu7A           ISIRMLINQHTLIFDPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMV
3d2rB           NQLQYFLDRFYMNRISTRMLMNQHILDVVAVVQDAFECSRMLCDQYYLSSPELKLTQVDQPIHIVYVPSH
1b63A           ------------------------------------------------MPIQVLPPQLANQIAAGEVVER
3d36B           EELDRAEAIITDYLTFAKPAPETPEKLNVKLEIERVI--DILRPLANMSCVD--IQATLAPFSVIGEREK
1aj6A           ------------------------------------------------KGLDAVRKRPGMYIGDTDDGTG
2c2aA           NHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTR
3ehjA           KDPEQAARELKSVQQTARTSLNEVRKIVSSKGIRLKDELINIKQILEAADIFIYEEEKWPENISLLNESC
2bu6A           ISIRMLINQHTLIFDKHIGSIDPNCNVSEVVKD-AYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMV
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1b62A           ------------------------------------------------MPIQVLPPQLANQIAAGEVVER
3crlA           ---------------------------------------------------------ATQPIHMVYVPSH


                         .         .         +         .         .         .         .:490
query           LQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVVDNGRGMSAEKLANIREKLSQRYFEHQASYSDQ
2bu8A           LYHMLFELFKNAMRATVESHESSLMVALGEEDLSIKMSDRGGGVPLRKI--------ERLFSYMYSTPLA
1bxdA           IKRAVANMVVNAARY--GNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGL
2bu7A           LYHMLFELFKNAMRASLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSY-----------MYST
3d2rB           LHHMLFELFKNAMRATVEHQENQPSLTPIKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPPLAG---
1b63A           PASVVKELVENSLDAGATRIDIDIE---RGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAI
3d36B           FRQCLLNVMKNAIEAMPNGGTLQVYVSIDNGRVLIRIADTGVGMTKEQL--------ERLGEPYFTTKGV
1aj6A           LHHMVFEVVDNAIDEALAGHCKEIIV-TIHADNSVSVQDDGRGIPTGIV----SAAEVIMTVLHAGG---
2c2aA           IRQVLLNLLNNGVKYSKKDAPDKYVKVIKDGGVLIIVEDNGIGIPDHAK--------DRIFEQ---FYRV
3ehjA           LKEAVTNVVKHSQAKT-----CRVDIQQLWKEVVITVSDDGTFKGEEN----------------------
2bu6A           LFELFKNATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFS-----------YMYST
2akpA           RYKSLSDPKQLETEPD-----LFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEA---
2dvyB           ------------VSFENGKIVVRLPITRPTSKIRVKKIENGVGIPVSTRKKSFPSDEN------------
1b62A           PASVVKELVENSLDAGATRIDIDIE---RGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAI
3crlA           LYHMLFELFKNAMRATVESHESKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSY-------MYSTAPLA


                         *         .         .         .         .         +         .:560
query           RQSIGIVNVHERFVLYFGDRYAITIESAEQAGVQYRITIQDx
2bu8A           GFGYGLPISRLYAKYFQGD---LQLFSMEGFGTDAVIYL---
1bxdA           GLAI-----VQRIVDNHNGM--LELGTSERGGLSIRAWL---
2bu7A           APGYGLPISRLYAKYFQGD---LQLFSMEGFGTDAVIYL---
3d2rB           -FGYGLPISRLYAKYFQGD---LNLYSLSGYGTDAIIYL---
1b63A           ISLGF-------------------------------------
3d36B           KGTGLGMMVVYRIIESMNGT--IRIESEIHKGTTVSIYL---
1aj6A           ------------------------------------------
2c2aA           DTGLGLAITKEIVELHGGR---IWVESEVGKGSRFFVWI---
3ehjA           ------------------------------------------
2bu6A           APGYGLPISRLYAKYFQGD---LQLFSMEGFGTDAVIYL---
2akpA           ---LSAGADVSMIGQFGV--GFYSLFLVADRVQVISKSNDD-
2dvyB           ------------------------------------------
1b62A           ISLGF-------------------------------------
3crlA           GFGYGLPISRLYAKYFQGD---LQLFSMEGFGTDAVIYL---