[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55806.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "3dvlC.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3dofB.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "2ekbA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"

## Summary of PDB Search
:234
    3e-35  26%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-33  11%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    4e-32  14%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    6e-31   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-30  13%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    8e-30  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    4e-29   9%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-28  12%  3cmvH  [x.x.x] PROTEIN RECA
    2e-28  16%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-28  20%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    1e-27  11%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    1e-27   8%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-27  11%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    3e-27   8%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    3e-27   9%  3cmvG  [x.x.x] PROTEIN RECA
    4e-27   9%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-26  10%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    1e-26  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-26   6%  2bifA  [c.37.1 - c.60.1] PROTEIN
    4e-26  12%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-25   8%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-25   6%  1aroP  [e.8.1] T7 RNA POLYMERASE
    3e-25  12%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    6e-25  10%  3cmvC  [x.x.x] PROTEIN RECA
    3e-24  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    3e-24   5%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    6e-24   9%  2axzC  [x.x.x] PRGX
    9e-24   9%  1e0jB  [c.37.1] DNA HELICASE
    3e-23  25%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-23   9%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    6e-23  15%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    8e-23   9%  2akaB  [x.x.x] DYNAMIN-1
    1e-22  14%  3cmvA  [x.x.x] PROTEIN RECA
    1e-22   8%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    3e-22   8%  1e98A  [c.37.1] THYMIDYLATE KINASE
    3e-22  21%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-22   7%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    1e-21  12%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-21  10%  1e0jA  [c.37.1] DNA HELICASE
    2e-21   9%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-21  13%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-20  11%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    1e-20   7%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-20   9%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    2e-20  13%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-20  11%  2cckA  [x.x.x] THYMIDYLATE KINASE
    2e-20  13%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    2e-20   8%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    4e-20   8%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-20   8%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    5e-20   9%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    6e-20   8%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    7e-20   8%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-20   5%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-19  23%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-19  13%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    1e-19   5%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-19  12%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-19   6%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-19  19%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    3e-19  10%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    4e-19  11%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-19   8%  2ctsA  [x.x.x] CITRATE SYNTHASE
    7e-19   6%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    1e-18  14%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-18   7%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-18  12%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-18   7%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    2e-18  11%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    2e-18   9%  4dcgA  [x.x.x] VP39
    3e-18  13%  3da4A  [x.x.x] COLICIN-M
    3e-18   9%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-18   8%  2cckB  [x.x.x] THYMIDYLATE KINASE
    4e-18  12%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-18  13%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    4e-18   6%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-18   8%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    6e-18   7%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    6e-18   9%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-18  10%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    8e-18   8%  2cgtH  [x.x.x] 60 KDA GROEL
    9e-18  10%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-17   5%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-17  13%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    2e-17   7%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    2e-17   9%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-17  13%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-17   6%  421pA  [x.x.x] H-RAS P21 PROTEIN
    4e-17  10%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-17   9%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    5e-17   5%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    6e-17  13%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-17  12%  3cm0A  [x.x.x] ADENYLATE KINASE
    8e-17  10%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    9e-17   8%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    1e-16   9%  3cmvE  [x.x.x] PROTEIN RECA
    1e-16  15%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-16   8%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    1e-16   8%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    2e-16   7%  3adkA  [x.x.x] ADENYLATE KINASE
    2e-16   8%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-16   8%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-16   9%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    3e-16   9%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    3e-16  11%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-16   9%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    4e-16  21%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-16  12%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-16  12%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-16  12%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    5e-16  11%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-16  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    5e-16  12%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-16   8%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-16  12%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-16  10%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-16   7%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    7e-16  10%  2bdtA  [x.x.x] BH3686
    8e-16  13%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    8e-16  13%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-16  11%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    1e-15   9%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    2e-15  12%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-15  11%  2c9oC  [x.x.x] RUVB-LIKE 1
    2e-15  10%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    2e-15   9%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    2e-15  10%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15  13%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    2e-15   8%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    3e-15  11%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-15   7%  3cmxA  [x.x.x] PROTEIN RECA
    3e-15  11%  2c0bL  [x.x.x] RIBONUCLEASE E
    3e-15  13%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-15  23%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    3e-15  13%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-15   6%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    4e-15  12%  3c8uA  [x.x.x] FRUCTOKINASE
    4e-15   7%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-15  10%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    5e-15   9%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-15   8%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    6e-15   7%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    6e-15  20%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-15  17%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    8e-15   9%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-15   5%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    9e-15   7%  3dlbB  [x.x.x] ARGONAUTE
    1e-14  12%  1e2iB  [c.37.1] THYMIDINE KINASE
    1e-14   7%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-14  10%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    1e-14  14%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    1e-14  10%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    1e-14  11%  2b8tB  [x.x.x] THYMIDINE KINASE
    2e-14  13%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-14  23%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-14   8%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-14  10%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    2e-14  11%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-14  12%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    2e-14  10%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    3e-14  13%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-14   9%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-14   9%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    4e-14   8%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    4e-14  12%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-14   9%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-14  10%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    5e-14   6%  2bhvA  [x.x.x] COMB10
    5e-14   9%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-14   9%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    6e-14   8%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    6e-14  22%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    6e-14  16%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-14  13%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-14  16%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    7e-14   7%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    7e-14  22%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-14  15%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    8e-14   9%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    9e-14  10%  1e6cA  [c.37.1] SHIKIMATE KINASE
    9e-14  11%  2b8tC  [x.x.x] THYMIDINE KINASE
    9e-14  10%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    1e-13  14%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    2e-13   8%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-13   7%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-13   7%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    2e-13  18%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-13  10%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    2e-13   8%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    2e-13  12%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-13   6%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-13  13%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    3e-13  12%  1adoA  [c.1.10] ALDOLASE
    3e-13  10%  2c4rL  [x.x.x] RIBONUCLEASE E
    3e-13  11%  2a1fF  [x.x.x] URIDYLATE KINASE
    6e-13  10%  1e2kA  [c.37.1] THYMIDINE KINASE
    6e-13   8%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-13   8%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-13  12%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-13  12%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    1e-12  10%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-12  13%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-12   7%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    1e-12  17%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-12   8%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-12  13%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    1e-12   7%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    2e-12   6%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-12  11%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-12  13%  3cmvB  [x.x.x] PROTEIN RECA
    2e-12  12%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-12  13%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-12  10%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    2e-12   8%  1e2hB  [c.37.1] THYMIDINE KINASE
    3e-12   9%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    3e-12   7%  3cmtD  [x.x.x] PROTEIN RECA
    3e-12  12%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-12  24%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-12   9%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    4e-12  10%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    4e-12   4%  2bhvD  [x.x.x] COMB10
    5e-12  13%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    5e-12   9%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    8e-12  21%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    9e-12   7%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    1e-11  11%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    1e-11   6%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-11   9%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-11   9%  1e2kB  [c.37.1] THYMIDINE KINASE
    3e-11  14%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    3e-11   7%  2bx2L  [x.x.x] RIBONUCLEASE E
    3e-11  11%  3bczC  [x.x.x] PROTEIN MEMO1
    4e-11  15%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-11  14%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    7e-11  10%  3be4A  [x.x.x] ADENYLATE KINASE
    1e-10  12%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    1e-10   6%  1e2nA  [c.37.1] THYMIDINE KINASE
    1e-10   8%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-10   6%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    2e-10  10%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-10  13%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    3e-10   9%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    4e-10  11%  2a1fD  [x.x.x] URIDYLATE KINASE
    4e-10  11%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-10  13%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    5e-10   8%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    6e-10   7%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    6e-10  20%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-10   9%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    8e-10   9%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    8e-10  14%  2c5mD  [x.x.x] CTP SYNTHASE
    9e-10  21%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-10   9%  2dftA  [x.x.x] SHIKIMATE KINASE
    9e-10  11%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-09  11%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-09   8%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    2e-09   6%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-09  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    2e-09  10%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    2e-09  11%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    2e-09   8%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-09   9%  1e2iA  [c.37.1] THYMIDINE KINASE
    3e-09   8%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    3e-09  10%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    5e-09   9%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-09   7%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    9e-09   7%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-09   8%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    1e-08   8%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-08  16%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    1e-08   8%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    1e-08  10%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-08  11%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-08  10%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-08  12%  2ancF  [x.x.x] GUANYLATE KINASE
    2e-08  14%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    2e-08  12%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    2e-08  10%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-08  10%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-08  18%  2d2fA  [x.x.x] SUFC PROTEIN
    3e-08   9%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    4e-08  15%  1chdA  [x.x.x] CHEB METHYLESTERASE
    5e-08   9%  3bm2B  [x.x.x] PROTEIN YDJA
    5e-08   8%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    6e-08  11%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-08   9%  2dftC  [x.x.x] SHIKIMATE KINASE
    7e-08   9%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-08   9%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    8e-08   9%  1e2jA  [c.37.1] THYMIDINE KINASE
    1e-07  10%  3a00B  [x.x.x] GUANYLATE KINASE
    1e-07  10%  1e2mB  [c.37.1] THYMIDINE KINASE
    2e-07  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    2e-07  10%  2bhvC  [x.x.x] COMB10
    2e-07   6%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-07  11%  2a1fC  [x.x.x] URIDYLATE KINASE
    2e-07  10%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-07   8%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    3e-07   6%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    3e-07  10%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-07  14%  3cmuA  [x.x.x] PROTEIN RECA
    3e-07   9%  1e2nB  [c.37.1] THYMIDINE KINASE
    4e-07   9%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-07   7%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-07   9%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    1e-06   8%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-06  13%  2ancB  [x.x.x] GUANYLATE KINASE
    1e-06  10%  2c9gA  [x.x.x] PENTON PROTEIN
    2e-06  10%  2b8tD  [x.x.x] THYMIDINE KINASE
    2e-06  11%  3a00A  [x.x.x] GUANYLATE KINASE
    2e-06  14%  2anbA  [x.x.x] GUANYLATE KINASE
    2e-06  10%  2an9A  [x.x.x] GUANYLATE KINASE
    2e-06   9%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    2e-06   9%  1e2mA  [c.37.1] THYMIDINE KINASE
    2e-06   8%  1e2lB  [c.37.1] THYMIDINE KINASE
    3e-06   9%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-06   6%  3ec1A  [x.x.x] YQEH GTPASE
    4e-06   7%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    5e-06   9%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    7e-06  11%  2cdnA  [x.x.x] ADENYLATE KINASE
    7e-06  11%  2c9oA  [x.x.x] RUVB-LIKE 1
    1e-05   5%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    1e-05   8%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-05  13%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-05  13%  2ancD  [x.x.x] GUANYLATE KINASE
    3e-05  17%  3dvlC  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    3e-05   9%  1e2lA  [c.37.1] THYMIDINE KINASE
    4e-05   9%  1eamA  [c.66.1] PROTEIN (VP39)
    4e-05  12%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    9e-05  15%  3cmwC  [x.x.x] PROTEIN RECA
    1e-04   9%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-04   9%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    3e-04   7%  3dofB  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 2-BINDING
    3e-04   8%  1e2hA  [c.37.1] THYMIDINE KINASE
    4e-04  11%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    5e-04  11%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    6e-04   4%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    6e-04   7%  3dfdA  [x.x.x] PROTEIN YQBN
    8e-04  12%  2ekbA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    9e-04  17%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
:234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRYITVEDLSFYYDKEPVLEHINYCVDSGEFVTLTGENGAAXTTLIKASLGILQPRIGKVAISKTNTQGK
3b5jA           ---ITFRNIRFRYKPPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIALADPNWL
2ccgB           ----------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMT------RE
2c03B           -AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRP----------
2dwoA           ---SRVQKIWVPVDH-RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRR
3dmdC           ---KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVI-----AAS
1e69A           -----------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
2czvA           ----------------GGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAIP
3cmvH           LGEDRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2d3wB           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVALSPEDRA
3b60A           ---LEFRNVTFTYPGRPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGREYTLA
2ccgA           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3eiuA           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFMGITNEEA
3dm5A           ---IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRP
1e9cA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAEL-----LRF
3cmvG           ---DRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2dwpA           --------------TQSRVQKIWVPVDHRNVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYR-
2ccjB           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
2c03A           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLL------VA
2bifA           -------------------------------IVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYR-
3dmdB           --VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSV----------
3b2qA           --PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAAAMGITNEE
1aroP           ----------------------------------------------------------------------
1d1cA           KGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQIL
3cmvC           ---DRSMDVETISSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2b8tA           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVDTRSIRNI
1bifA           ----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYR-
2axzC           ----------------------------------------------------------------------
1e0jB           --LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
2awnC           ---------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVGMVF------------
1e9fA           ----------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRA-----ELLRF
2c04A           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR-
2akaB           ------EDLIPLVNQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVVLQLVNST
3cmvA           -----VETISTGS---LSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL-
2c61B           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFMGITNEEA
1e98A           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAEL-----LRF
2bbsA           ---EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKH--------
2a5gA           ----------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY
3b85A           -----------IRPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEA
1e0jA           IREHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
2b8wA           ---CLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
1dhjA           ----------------------------------------------------------------------
3d3kA           ---LVVPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALGPHVKGAQGISCG
2a2zD           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVNVQSTNV
1bg0A           --FDSIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTPPKQWGD
2d0kA           ----------------------------------------------------------------------
2cckA           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPG----
1cr4A           -HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG------------
1e2dA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
3b2qB           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVAFAVVFAAMGITNEE
3c95A           --HPENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGIDNLKILRE
1e3mB           --------------------------------------------LAERAYTLNYTCPTFIDKPGIRITEG
1e9dA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAEL-----LRF
1e9rA           ---GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3dt2A           ---LRIASRLAKEEGWMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2awnB           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
3d7wA           ---DYVSSGSFSNNI-PLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAG-----NQS
3dt4C           CFALRIASRLAKEEEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDAWMKFDA
2cjwB           ----------------------------YYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVTIILLDMW
3dtbB           -RIASRLAKEEWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2d62A           ---VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPE
2dr3A           ----------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYV-------
2awnD           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2ctsA           ---------ASSTNLKDILADLIPKERIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEG
2a30D           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
3a1wA           -------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGV
3eiuB           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFMGITNEEA
3cr7C           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYDGDNIRFG
2dr3B           ----------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQ----------------------
1dkiA           KSLLDSKGIHYNQNPYNLLTPVIEKVKPGEQVGQHAATGSVATATAQIMKYHNYPNKGLKDY-----TYT
4dcgA           ---ESANEVAKKLPYQGQLKFLSKLQRGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWRHHDPILN
3da4A           ---VLHPGISVYDAYHF---AKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLK
1e9sG           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVINGDMLSKF
2cckB           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3czpB           -----------EQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEE
2axpA           ------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAGNEK
2bc9A           ---CLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
2bhjA           -----------------------------------------------------------LHHKATSCLGS
2a30B           ----------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVL
1e9sF           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3bgwA           --------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
2cgtH           ---KSFGAPTITKDGVSVAREIELEDKFNMGAQMVKEVASKANDAAGDGTTTATVLAQAIITKALSVPCS
3bgwD           ----------GVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
3dt4A           ---LRIASRLAKEEEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
3dauA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1e9sD           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
5dfrA           ----------------------------------------------------------------------
421pA           ----------------------------EYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTRKQVVIDGE
3czpA           DKDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAEEERAQ
2c9yA           ----------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVAS
2c61A           ---YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
1dhiA           ----------------------------------------------------------------------
3cm0A           ----------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDHVARGTPL
3dfoD           ----------------------------------------------------------------------
2a2zA           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEP------VA
3cmvE           LGEDRSMDVETISTGSLSLDIALGALPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2d4uA           ---------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWV
3bpbA           ---IIARTPARSLVDSSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVFVEDPVLCTSRC
1dg3A           ---CLIENTNGRLANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPG
3adkA           ---------------------MEEKLKKSKIIFVVGGPGSGKGTKIVQKYGYTHLSTGDLLRAEVSSGSA
1e9sB           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVINGDMLSKF
3bh0A           ---SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMS-------DNDDVVNLH
2dflA           ---ERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYID
1e3aB           ------------WTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPKVYNPQSGYIANWNN
3cr7D           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIL
3czjA           ----------------------------------------------------------------------
2awoA           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
3dfnA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3bjdB           --------------------------------------------------QLQNLPIEEARIV-----AD
3dfnC           ----------------------------------------------------------------------
1e3mA           --------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRRHPVVEQ
3dftD           ----------------------------------------------------------------------
2d4hA           ---CLIENTNGRLANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQWMWCVPH
3dfqD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3bo6B           --FHSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDK
2bdtA           -----------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGG
1cr1A           EHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
2drcA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2c9oC           LAKQAASGLVGQENCGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSPMVGSEVYSTEIKKT
1cfrA           ---------------------------------IISKSGEGNKYTINSAIAFVAYDINTTEFSKVLINDE
2a5jA           -------------------------------YIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDG
1e9sJ           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPN----
1cr2A           -HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
1e2fA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAEL-----LRF
3dfpC           ----------------------------------------------------------------------
3cmxA           -------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDALDPIY
2c0bL           ----------------------------------------------------------------------
3cr7A           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDNIRFG
3dhwC           ---IKLSNITKVFHQGQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTL
1draA           ----------------------------------------------------------------------
2a30A           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVS
3c8uA           ---------TLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPDGFH--
3cddF           ----------DESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPIVNTDVGEPFQRIQI
2c7cH           ---------------------------------LAQAIITEGLKAVAAGMNPMDLKRGDKAVTAAVEELK
2b92B           ---CLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
3dyoA           ----------------------------------------------------------------------
2a2zB           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
2bbsB           ----TTEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKI----------
2d4uB           ----------------------------------------------------------------------
1e9rE           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3dt7A           CFALRIASRLAKEEEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
3dlbB           -------------------------VEGLAVYRREHARGPGWRVLGG----------------AVLDLWV
1e2iB           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY----------
1e4yA           -------------------------------IILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
3dymA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3cbnA           -------------------------------------------------LGVLR---YTLRAGHPNVTAG
2b8tB           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIL--
1drbA           ----------------------------------------------------------------------
2bbtB           ---ELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGK-----------
3cddD           -------EIVLKAGGKIYQGWTKIGIGAFDLETYKFNDAQYKAFIEKQGQACTVDIGGERVI---TGYVD
2dr3E           ----------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGEEHPVQVRQN
3dfnD           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1bmfC           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGT------DEKK
1dyhA           ----------------------------------------------------------------------
3bb1B           ---SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVS
2bkiA           ---SLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEA
1cjaA           ----------DKSFRVITTLANQANILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDNSDRLP
3dfqC           ----------------------------------------------------------------------
1e9rD           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2akaA           ---------PHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQ
2bhvA           ----------------------------------------------------------------------
2d4hB           ---CLIENTNGRLANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLWCVPHPKKPGHILGLGQNDSW
2bjbA           -----------GVGSELTVSGRIEPGPGARVDC--GLAG----TVLRFVPPLAALGSVPVTFDGDQARGR
1dp0A           ----------------------------------------------------------------------
3d31A           ---IEIESLSRKWKN-FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDL
2d3wD           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREGGTVEFKGKDLLALSPE
4dfrA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2bkhA           ------TMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIV--
2awoC           ---------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-----GEK
3dm9B           ---AVKEAVSEILESRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTF--
1d6jB           ------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
1e6cA           -----------------------------EPIFMVGARGCGMTTVGRELARALGYDIFMQHTSGMTVADV
2b8tC           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKDSRTGT
2czvB           --------VKFIEMDIRDKEAYELAKEWFEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRD
1eilA           ----------------------------------------------------------------------
3bb1A           ---SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMS
1bglA           ----------------------------------------------------------------------
2eg5G           ---YNQLVLAKVKPVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKVGQLERPTIQIFLN
2d2eA           ---LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENIL
3dffA           ----------------------------------------------------------------------
2ck3C           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
3dfoC           ----------------------------------------------------------------------
2b8wB           ---CLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
1cr0A           --LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKK----------
1adoA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e2kA           ----------------------------LLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGAS
1e9sM           ---GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVINGDMLSKF
3bb1F           ---SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
3bv4A           ----------------------------------------------------------------------
3clvA           -------------------------KKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGNENLCNI
3bb1E           ---SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
3cr7B           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
2bwjA           ---------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFSTGELLREELASESE
2d3wA           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
3bb1C           ---SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
2ausC           ----------------------------------------------------------------------
3ch4B           ---------------------APLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQ
1ak2A           ----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVAS
3cnnA           ----------THKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDT
3cmvB           ---DRSMDVETISTGSLSLALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2aunB           ----------------------------------------------------------------------
3cnlA           ----------THKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILD
3ecpA           ----------------------------------------------------------------------
1e2hB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
1e59A           -----------------------VLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFD
3cmtD           -------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDALDPIY
3d3qA           ----------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDKV
3bk7A           ----------VKDYGSFKLEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYKP
2cvfA           -----------------LDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPER
1ai4B           ---------------------LTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPKVYNPQSGYIANWNN
2bhvD           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2dr3D           ----------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGE------------
1b0uA           ---LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLIIVNGQNINLVRDKDGQLKVADKN
2bv7A           --------------------------------------------------TKIKAVYDTNP-TKFRTLQN
1d8jA           ----------------------------------------------------------------------
1afrA           ----------------EVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGF
3cddC           -------------------------------LKAGGKIYQGWTKIGIT-RSLEASGAFDLETYKFQYKQG
1e2kB           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRD--------------
3d1mB           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bczC           ---------------------------SWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGS
2d3wC           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKPEDRA
2aumB           ----------------------------------------------------------------------
3be4A           -------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKN
2bofX           ---------------------------------------------------------SSAEWVRNNPNDP
1e2nA           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
3cioD           --------------------FAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRG
3brwA           KVKLECNPTARIYRKKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLR-----------------LLLRTK
2bkeA           LEVKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYID
4atjA           ----------------------------------------------------------------------
3di4A           -----------GEVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHNLHDLTERFFSGKTRALHGTHV
2a1fD           ----------------------------------------------------------------------
1d6jA           ----------------TRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3dvlD           -------------------------LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETP
2ahwD           -----VKPPRINGRPVLSAQEAVNYIPDEATLCVGGGILEATTLITALADKYKQTQTPRNLSIISPTGLP
1e2gA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2bbtA           ---EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
3dm5B           ---IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRP
2d7vA           AFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKH
2c5mD           ----------------------------------------------------------------------
2awnA           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--
2dftA           -------------------------------AVLVGLPGSGKSTIGRRLAKALGVGLIEQRTGRSIADIF
1dekB           -------------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPI------
3crmA           ----------------------------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMG
2aexA           ----------------------------------------------------------------------
1dekA           -------------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAY
2ccjA           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3bwdD           ----------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGE
3cueF           -------------------------YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVLDGK
1e9sH           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1e2iA           ----------------------------LLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYT
2ahvA           -----VKPPRINGRPVLSAQEAVNYIPDEATLCVLGAGGGILETLITALADKYKQTQTPRNLSIISPTGL
2d7vB           AFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKH
1e9rG           ---GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMF
1cjtC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKNLKEAIETIV
1e9rF           ---GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVINGDMLSKF
2dr3F           ----------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLK------------MGE
1e9sA           ---GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3ed8A           ---IELKGTDFKEDG-NILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQ--Q
1av6A           ---PESANEVAKKLPYQLLGELFFLSKGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
1akeA           -------------------------------IILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAV--
2e85A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2ancF           ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGV
1ckvA           ---AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAG-
3b85B           ----------------LGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEA
3bb1H           ---SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
3d3qB           ----------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIG
2d2fA           ---LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENIL
2dpyB           --PLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGGREVKDFIE
1chdA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1bccF           --------------------------------------------------------------SRWLEGIR
2awoD           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2dftC           -------------------------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGR
3bb1G           ---SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
1cs4C           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
1e2jA           ----------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASE
3a00B           -----------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1e2mB           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRE
1accA           ----------IQETTARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIAFGF-----------NEP
2bhvC           ----------------------------------------------------------------------
1e4vA           -------------------------------IILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
2a1fC           ----------------------------------------------------------------------
1culC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQNNLKEAIE
3cqcA           ---KQGNAIMRKFLASEAAKEVFVKIPQDSIAEIYLPAE-----------------DDNAIREHLCIRAY
2dr3C           ----------------------------------TRRVKTGIPGVDEILHGGIPERNVVLLSGGPTIFSQ
1e9sI           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGD------------
3cmuA           -------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
1e2nB           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEWRVLGAS
1e9sL           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVINGDMLSKF
1e9sE           ---GKLKRMTREKAKQVTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGLLRGDRMVINGDMLSKF
3b9qA           ---KDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFRA
1dvrA           ----------------------------SIRMVLIGPPGAGKGTQAPNLQERFHAAHLARSQIAKGTQLG
2ancB           ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPR
2c9gA           ARVMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVL------------
2b8tD           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADPKSIRNIQSRTGT
3a00A           -------------------------------IVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
2anbA           ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPR
2an9A           ----------------------------GTLYIVSAPSGAGKSSLIQ-----ALLKTQPLYDTQVSVSHT
3c7kC           -------------------------------LLLLGAGESGKSTIVKQMKIIHED--------GFSGEDV
1e2mA           ----------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYV-PEPMTYWRVLGAS
1e2lB           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
3bb1D           ---SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERPFQSEGPRPVMVSRSRA
3ec1A           CPVDVCLVSAAKGIGMAKVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPGTTL
1e1qB           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRDEKKKLYCIYVAIGQ
1c9kC           -------------------------------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDG
2cdnA           ----------------------------HMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEE
2c9oA           LAKQAASGLVGQENAGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
2b0lC           ----------------------------------------------------------------------
1e9rB           ---GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2dpyA           --PLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGGREVKDFIE
2ancD           ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPR
3dvlC           ----------------------------GRSTLVSGTSGTGKTLFSILYNGIIEFDEPGVFVTFEET---
1e2lA           ----------------------------LLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVASETIAN
1eamA           -------------------------RHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLID----
3e70C           ---EAVSEILETSRR-IDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNH--------------
3cmwC           -------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDALDPIY
1cjuC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNATKVQDIKNNLKEAI
1ek0A           -------------------------------LVLLGEAAVGKSSIVLRFVSNDFAENKEPTLTQRVTINE
3dofB           ----------------------------------------------------------------------
1e2hA           ----------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRSETIAN
3c85A           --------------------------------------------LINPGHAQV--LILGGRIGTGAYDEL
3cddA           --------------------------IYQGWTKIGITRSLEASGAFDLETYKFLGNDKAFIEPIKQGQAC
3bjqB           ----------------------------------------------------------------------
3dfdA           ---IDAEEVEVPISKRFVDKEFIFKAITTDRIDELEKENTTKELDSQRFYARI--AVETTVYPTFKAKEL
2ekbA           ----------------------------------------------------------------------
2ax4B           ----------------------------GCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRH


                         .         .         *         .         .         .         .:140
query           KLRIAYLPQQIASFNAGFPSTVYEFVKSGRYPRKGWFRRLNAHDEEHIKASLDSVGMWEHRDKRLGSLSG
3b5jA           RRQVGVVLQDNVLLNRSIIDNISLAN---PGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSG
2ccgB           PGGVPTGEEIRKIVLEGNDMDIRTEA----MLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGY
2c03B           ---------LLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAG
2dwoA           EAVKQYSSYNFFRPD------------------NEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATN
3dmdC           DTFRAGAIEQLEEHAKRIGVKVIKHSY--------------GADPAAVAYDAIQHAKARGIDVVLIDTAG
1e69A           GSAFEENGEEITVARELGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSG
2czvA           SLVRDTVQKFKSYLIYVESNDLRVIRYSIEIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNP
3cmvH           PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSAALTPKAEIEGEIGDSHMGLAARMM
2d3wB           GEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPLLTRSVNVGFSG
3b60A           SLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSG
2ccgA           GEEIRKIVLEGNDMDIRTEAMLFAA----------SRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGY
3eiuA           QYFMSDFEKTGALERA---VVFLNLADDPAVERIILTDITNYAEALRQMGPGYMYTDLATLYERAGIVKG
3dm5A           GAYHQL-------------------RQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAG
1e9cA           PERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENF
3cmvG           PIYARKLGVDIDNLLCSQPDTGEQALEICD-----ALARSGAVDVIVVDSVAALTPKAEIEGLAARMMSQ
2dwpA           -----------------REAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATN
2ccjB           GEEIRKIVLEGNDMDIRTEAMLFAAS----------RREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGY
2c03A           ADTQRPAAREQLRLL-------------GEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAG
2bifA           -----------------RDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATN
3dmdB           ---------VIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAG
3b2qA           AQYFMSDFEK---TGALERAVVFLNLADDPAVERIVTPR---MALTAAEYLAYEHGMHVLVILTDITNYA
1aroP           --------------------NDFSDIELAAIPFNTLADH------YGERLAREQLALEESYEMGEARFRK
1d1cA           QANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLA
3cmvC           PIYARKLGVDIDNLLCSQPDTGEQALEICD-----ALARSGAVDVIVVDSVAALTPKAEIEGLAARMMSQ
2b8tA           QSRTGTSLPSVEVESAPEILNYIMSTKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFG
1bifA           -----------------RDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATN
2axzC           --KRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVS
1e0jB           EETAEDLIGLHNRVRLRQSDSLKREIIENGKFD-------QWFDELFGNDTFHLYDSFAEAETDRLLAKL
2awnC           -------QSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV--------LQLAHLLDRKPKALSG
1e9fA           PERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENF
2c04A           ------------------PAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAG
2akaB           TEYAEFLHCKGKKFTDFEEVRLEIEAVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPD
3cmvA           -------------------------------DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAV
2c61B           QYFMSDFEKTGALERALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGYPGYMYTDLATLYERAGIVKG
1e98A           PERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENF
2bbsA           ---------SGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSG
2a5gA           KNVDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDA
3b85A           GEKLGFLPGDPYRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQKFLTRL
1e0jA           EETAEDLIGLHNRVRLRQSDSLK-------REIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKL
2b8wA           KPGHILVLLDTEGLNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVT--ELTHRIRSKSVSFFPD
1dhjA           -------------------------------------------MENAMPWNLPASLAWFKRNTLDKPVIM
3d3kA           RHLANHDVQVILFL---PNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRD
2a2zD           LQMMYEKPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
1bg0A           INTLVGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQY--KEMEEKVSSTLSSMEDELKGTYYPLGMSK
2d0kA           -------------------------------------------NENALPWNLPADLAWFKRNTLNKPVIY
2cckA           ---GVPTGEEIRKIVLEDMDIRTEAMLFAASRREHLVLKVIPALK---------EGKVVLCDRYIDSSLA
1cr4A           --KKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAET
1e2dA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEK----LSQGVTLVVDRYAFSGVAFTGAKENFS
3b2qB           AQYFMSDFEKTGALERAAEYLAYEHGMHVLVILTDITNYAEALRQMGRGYPGYMYTDLATLYERAGIVKG
3c95A           NPQVREKVVAIFAESDNVDAQLYNGFAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYRARNFPGTLDY
1e3mB           RHPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALILAYIGSYVPAQKVEIGPIDRIFTRVG
1e9dA           PERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENF
1e9rA           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYA----LSVVPRGKTDEAEEWASYGRLLLRETAKK
3dt2A           AQGNLRAINPENGFFGVAPGSVKTNPNAIKT-IQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKN
2awnB           PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV----AEVLQLAHLLDRKPKALSG
3d7wA           YFLSDAPAGA------------ETQDFSGTTSSSQPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRF
3dt4C           QGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFT-NVAETSDGGVYWEGIDEPLAPGVTITSWKN
2cjwB           ENHDHMQVG----DAYLIVYSITDRASFEKASELRIQLR---RARQTEDIPIILVGNKSDLVRREVSVSE
3dtbB           AQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKN
2d62A           KGVFVPPKERD--VAVFQSYALYPHTVYDNIAFPLKLRKVPKQEIDKRVREVAELGLTELLNRKPRELSG
2dr3A           ----------------ALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDI
2awnD           PPA-ERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2ctsA           IRFRGYSIPECQKMKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHP
2a30D           STNVLQMMYEKPERWSFTFQTYACLAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
3a1wA           FTYKGYTINLIDLPGTYSLGSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAM
3eiuB           QYFMSDFEKTGALERA---VVFLNLAHVLVILTDITNYAEALRQMGAAGYPGYMYTDLATLYERAGIVKG
3cr7C           LNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFPKGLYKKAREG
2dr3B           -FLWNGLKMGEPGIYVALEEHPVQVRQ---NMAQFGWDVKPYEEKGMFAMVDAFTAGIGEKYIVHDLTDI
1dkiA           LSSNNPYFNHPKNLFAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGI--SVDMDYGPSSGSAGS
4dcgA           GLRDVTLVTRFRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILLKWRCPFPAQWIKDFYIPH
3da4A           ISPMKINQIKDIVSTKFTHATGDYNVITGAYLGNITGVVRSYDDKYDFNASTHRGIIGESLTRLGAMFSG
1e9sG           GRDKDIILNPYDQR--TKGWSFFNEIRNDQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
2cckB           GEEIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDQGYARGIGVEEVRALNEFA
3czpB           RAQ----PYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGAIDK
2axpA           LFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEG
2bc9A           MWCVPH----------------PKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGT
2bhjA           IMNLTRGPRDKPTP---LEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDELIF
2a30B           QMMYEKPERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQ
1e9sF           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDW-----------------------QRYALSVVPRGKTD
3bgwA           ENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNS-------------NINIFDKAGQSVNY
2cgtH           DSKAIAQVGTISANSD---ETVGKLIAEAMDKVG----KEGVITVEDGTGLQDELDVVEGMQFDRGYLSP
3bgwD           ENIKRLIVTA-------GSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTR
3dt4A           AQGNRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYW-EGIDEPLAPGVTITSWKN
3dauA           -----------------SLIALAVDRVIGM--------------ENAMPWNLPADLAWFKRNTLNKPVIM
3b55A           -----------------------------------------------NTNQIAKWLEAHAKPLKTTNPTA
1e9sD           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDW-----------------------QRYALSVVPRGKTD
5dfrA           -------------------------------------------DRVIGPWNLPADLAWFKRNTLDKPVIM
421pA           TCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCD
3czpA           PYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEELSEYGIIVVKFWLAIDK
2c9yA           GSGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEF
2c61A           IEAQYFMSDFEKTGALERAVVFLNLADDPA-----VERIVTPRMALTAAEYLAYEHGMHVLVILTDITNY
1dhiA           -----------------SLIALAVDRVIGM--------------ENAMPWNLPASLAWFKRNTLDKPVIM
3cm0A           GERVRPIMERGDLVPDDL---ILELIREELAERVIFDGFPRLAQAEALDRLLSETGT-----RLLGVVLV
3dfoD           --------------------------------------------------------------SHPALTPE
2a2zA           RWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRYIFASNYESEC
3cmvE           PIYARKLGVDIDNLLCSQPDTGEQALEICDA-----LARSGAVDVIVVDSVAALTPKAEIEGLAARMMSQ
2d4uA           ALLQTRNTLMMDQNNIGSGSTVAELMESASISLKQAEKNWADYEALPRDP-RQSTAAAAEIKRNYDIYHN
3bpbA           AIITRPGAESRRGETEIIEETVQRFYPGKVERIEAPGTV--EAGDIMMVGDHFYIGESARTNAEGARQMI
1dg3A           HILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELIRSKSDSADFVS
3adkA           RGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQG----EEFERKIGQPTLLLYV
1e9sB           GRDKDIILNPYDQR---TKGWSFFNEIRNDY----DWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
3bh0A           SLEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTR
2dflA           TEGTFRWERIE------------------NMAKALGLDIDNVMNNIYYIRAINTDHQIAIVDDLQELVSK
1e3aB           SPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQ
3cr7D           NKDLGFSEADRNENIRRIAEVAKLFADSIAITSFISPYRKDRDTARQLHEVAEETGLPDPKGLYKKAREG
3czjA           ----------------------CIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDTRAPLDNDIGVSE
2awoA           PPAERGVGMVFQSYALYP----HLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
3dfnA           --------------------------------------------------------------SHPALTPE
3dfqA           --------------------------------------------------------------SHPALTPE
3bjdB           ALAVHATSRQIDSAASKLAALAEAGLKGDRYQQLLYVLSLSDVATAQTRRWLARAIYRVEERFPAADLSR
3dfnC           -------------------------------------------------------------HSHPALTPE
1e3mA           VLNEPFIANPLNLSP---QRRLIITGPNGGKSTYRQTAL----IALAYIGSYVPAQKVEIGPIDRIFTRV
3dftD           --------------------------------------------------------------SHPALTPE
2d4hA           PKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGTINQQAMDLYYVTELTHRIRSKSSPD
3dfqD           --------------------------------------------------------------SHPALTPE
3dfpD           --------------------------------------------------------------SHPALTPE
3bo6B           FHISVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDQENSQYSASSLH
2bdtA           YRPPWESWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDAL
1cr1A           EETAEDLIGLHNRVRLRQS----------------DSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEA
2drcA           -------------------------------------------MENAMPFNLPADLAWFKRNTLDKPVIM
1aldA           -------------------------------------------------------------YQYPALTPE
2boeX           --------------------------------------------RDRIASVPQGTWFAHHN---PGQITG
3dftC           --------------------------------------------------------------SHPALTPE
2c9oC           EVLMENFRRAIGLR---IKETKKKEIIQDVTLHDLD-VAGEINKVVNKYIDQGIAELVPGVLFVDEVHML
1cfrA           AIRLGGKISDGSFNKCNGDWTNFIVVKMPNATSFDVMSIYKSCLSEFIYDLRSKLSLNN-----VNLITS
2a5jA           KQIKLQIWDAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDL
1e9sJ           ---GDMLSKFGRDKDIILNPYD-------QRTKGWSFFNEIRNDYDW---------QRYALSVVPRGKTD
1cr2A           EETAEDLIGLHNRVRLRQS---------------DSLKREIIENGKFDQWFDELFGNDTFHLYDSFEAET
1e2fA           PERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENF
3dfpC           -------------------------------------------------------------HSHPALTPE
3cmxA           ARKLGVDIDNLLCS---QPDTGEQALEICDALARLTPKAEARMMSQAMRKLAGNLKQSNTLLIFINQIRN
2c0bL           ----PFLIHQESNV---IVRAFRDYLRQDIGEILIDNPKVLELARQHIAA-LGRPDFSSKIKLYTGEIPL
3cr7A           LNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFPKGLYKKAREG
3dhwC           SESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEKRRVTELLSLVGLGDKHDSYPSNLSG
1draA           --------------------------------------------ENAMPWNLPAELAWFKRNTLDKPVIM
2a30A           TNVLQMMYEKPERWSFTFQTYACLSRIRAQLAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
3c8uA           --LDNRLLEPRGLL---PRKGAPETFDFEGFQRLCH------------ALKHQERVIYPLFDRARDIAIA
3cddF           EQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIKAA
2c7cH           ALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSP
2b92B           MWCVPHLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINAMDQLYYVTELTHRIRSKSSFVS
3dyoA           ------------------------------FNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSE
2a2zB           STNVLQWSFTFQTYACLSRIRAQLASLNGEKPVLFFE---RSVYSDRYIFASNLYESECMNETEWTIYQD
2bbsB           -----KHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSG
2d4uB           RAGIRYMMDQ---NN-IGSGTVAELMESASISLKQAEKNWAD-YEALPRDPRQSTAAAAEIKRNYDIYHN
1e9rE           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTD-----------------------
3dt7A           AQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKN
3dlbB           SDSGAFLLEVDPAYRILCEMSLEAWLAQGHVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGR
1e2iB           ------VPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIG
1e4yA           GSELGK-----------------------QAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPR
3dymA           ------------------------------WQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGV
3d1mA           ------------------------------------------------------PNVAEKTLGASGRYEG
3cbnA           HRTTFEVTVD-------PEIGETADCIIGVSSSDSISTLPDEKRAIARESLVRVIGYDEIRGYGHPELTL
2b8tB           --PSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFG
1drbA           -------------------------------------------MENAMPWNLPACLAWFKRNTLDKPVIM
2bbtB           -----IKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSG
3cddD           DWVPSYDESTITSVSGRDKTADLVDCSIDYPSGQ----FNNQTLTQIADIVCKPFGIKVIVNTDVGEIEQ
2dr3E           MAQFGWDVKPYEEK----------------------------GMFAMVDAFTAGIGKEYEKYIVHDLTDI
3dfnD           -------------------------------------------------------------HSHPALTPE
6aldA           --------------------------------------------------------------SHPALTPE
1bmfC           KLYCIYVAIGQK--------------------RSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP
1dyhA           -------------------------------------------MENAMPWNLPADLAWFKRNTLDKPVIM
3bb1B           RSRAGFTLNIIDTLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGI
2bkiA           NPLLEAFGNAKTVRNN-NSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAG
1cjaA           IAWTNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFHSIRDIITLYT
3dfqC           --------------------------------------------------------------SHPALTPE
1e9rD           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEA---------------------
2akaA           ANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAG
2bhvA           --KLLRTITADKMIP---AFLITPISSQIAGKVIAQVES---DIFAHMGKAVLIPKGSKVIGYYSNNNKM
2d4hB           IFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADG
2bjbA           PIALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGLLLSAAS-----------------FT
1dp0A           ------------------------------FNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSE
3d31A           SPEKHDIAFV-------YQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPLTLSG
2d3wD           DRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSTLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSG
4dfrA           -------------------------------------------MENAMPWNLPADLAWFKRNTLDKPVIM
2e85B           --------------------------------------------------------CAAAPKGNWVVIDG
2bkhA           EANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLEKSRICVQGKEERNYHIFYRLCAG
2awoC           RMND---TPPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
3dm9B           --RAGAIEQ-----------------LEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDT
1d6jB           FGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDTARQLHEVATPGEETGLPFVEVYV
1e6cA           VAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEMRAHGTVVYLFAPAEELALRLQASLQAHQRPTL
2b8tC           SLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFG
2czvB           TVQKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDP--GIDHVLAKLMVKKNVALGFSLRPLLYSNP
1eilA           --------------------------------------------GYLGFAVKDVPAWDHFLTKSVGLMAA
3bb1A           RAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGI
1bglA           ------------------------------FNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSE
2eg5G           NSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWGLVTEIGTNKGSIYS
2d2eA           ELSPDERARKGLFLAFQYPVVPGVTIANFRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNE
3dffA           --NVLVYTVFAGAAQPPYSPAAQRHTIWGLAPDDDA----VLYRRKEDIAALDHLRVARHGRFLDSIYRK
2ck3C           VAI--------------------------GQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP
3dfoC           --------------------------------------------------------------SHPALTPE
2b8wB           MWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNS----IGTINQQAMDQLYYV
1cr0A           ------VGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEA
1adoA           --------------------------------------------------------------SHPALTPE
2c4rL           --PAPFLIHQ---ESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAA-LGRPDFSSKIKLYTGEIPL
2a1fF           --------------------------------------------------------------------SQ
1e2kA           ETIANIYTTQHRLDQGEISAGDAAVVMTS-------AQITMGMPYAVT------------DAVLAPHIGG
1e9sM           GRDKDIILNPYDQR--TKGWSFFNEI-----RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
3bb1F           SAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGI
3bv4A           -------------------------------------------------------------------TPE
3clvA           KFDIWDTAGQERYASI------VPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNYIIILVANKI
3bb1E           SRSRAGFTLNIPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGI
3cr7B           FGKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYVDAEQR
2bwjA           RSKLIRDIME--RGDLVPSGIVLELLK--EAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICM
2d3wA           ALSPEDRAGEGIFMAFQYPVEIPGVSNQRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSG
3bb1C           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLDRLDAYRVDNLDKLVAKAITDSFGKGI
2ausC           ---------------------------------------------------------VINLDKPPGPTSH
3ch4B           YAQFQYKEAFRKDMICRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVAQSRQQRGWVFTPG
1ak2A           GSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLLMEKRKEKLDSVIEF
3cnnA           PGILYKNIFSE--DLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLKKG
3cmvB           PIYARKLGVDIDNLLCSQPDTGEQA----------LEICDALARSGAVDVSVAALTPKAEIGLAARMMSQ
2aunB           -----------------------------DQTWQPIDGRVATEVLEATLRQLEVHGVDRHVEARYRYLAG
3cnlA           TPGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEF-FEDFARKRGLLKKG
3ecpA           ---AKSVFSSAALGDPRRTALVNVAAQLAKYSGKSITISSEG-SKAAQEGAYRFIRNPNVSAEA--IRKA
1e2hB           LGASETIANIYTTQHRLDQGEISAITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPA
1e59A           FAYTSVLKRNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKD
3cmtD           ARKLGVDIDNLLCSQPDTGEQALEICDAALTPKAEMGLA-ARMMSQAMRKLAGNLKQSNTLLIFINQIRM
3d3qA           TTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITPIIAGGTGLYIQSLLYNYAFEISEDKKQVKLKL
3bk7A           QYIKAEYEGTVYELLS-------------------KIDSSKLNSNFYKTELLKPLGIIDLYDRNVEDLSG
2cvfA           LVQTRGLNPEEALS---RFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDRSGLIAELSRQLQVLLWIA
1ai4B           SPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQ
2bhvD           --KLLRTITADKMIP---AFLITPISSQIAGKVIAQVESDIFAHMGKA---VLIPKGSKVIGYYSNNNKM
2aumA           --------------------GRVALIAPASAIAT--------EVLEATLRQLEVHGVDRHVEARYRYLAG
2dr3D           -------PGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDLTDIRE
1b0uA           QLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSG
2bv7A           ILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMAL--KKYH
1d8jA           --------------------------------------GYKFGVLAKIVNYMKTRHQRDEILDETQHLDI
1afrA           DEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGF
3cddC           QACTVDIGGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPTQIADIVCKPFGIKVIVNTDVGEIEQ
1e2kB           --DIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIG
3d1mB           ------------------------------------------------------PNVAEKTLGASGRYEG
2bx2L           -----------------VIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKIKLYTGEIPL
3bczC           CAAHAQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEH
2d3wC           GEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSG
2aumB           --------------------GRVALIAPASAIAT--------EVLEATLRQLEVHGVDRHVEARYRYLAG
3be4A           GIGLDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDS-LTSVIYFEIDDSEIIERIS
2bofX           RTPIASVPQG----------TWFAHHNPGQITGQVDALMSAAQAAGKI---PILVVSNAPGRDCGAPSHS
1e2nA           LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRH
3cioD           YSHSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDT
3brwA           CRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTF----DEHVISNNFKFGVIYQ
2bkeA           T--------------------EGTFRWERIENAKALGLDIDNVNNIYYIRAINTDHQIAIVDDLQELVSK
4atjA           --------------------DAFGNANSARGFP--VIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAG
3di4A           TTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHSNLTTGLPL
2a1fD           --------------------------------------------------------------------SQ
1d6jA           FGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRK-----------DRDTARQLHEVATP
3dvlD           QDIIKNARSFGWDLA--------------KLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQK
2ahwD           LAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTLRAHQPGIISDIGIGTFVDPRQQGGKL
1e2gA           EIGKLLSSYLQ-KKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDR----YAFSGVAFTGAKENF
2bbtA           QNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISK---------------FAEKDNIVLGGITLSG
3dm5B           GAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDY--------------------FKSKGVDIIIVDTA
2d7vA           HLAHENCFIANSVET-------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2awnA           -----------------------------DTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIG------
2dftA           ATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNDR-AE
1dekB           KDALAYAWGVFAANTDY---PLTRKEFEGIDYDRETNLNL------------TKLEVITIMEQAFCYLNG
3crmA           TAKPSRELLARYPHRLIDIRDPAESYSAAE-------FRADALAAMAKATARGRIPLLVGGTMLYYKALL
2aexA           ----------------------------------------------------------------------
1dekA           AWGVFAANTDYPLTRKEFEGIDYTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDV
2ccjA           GEEIRKIVLEGNDMDIRTEAMLFAA----------SRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGY
3bwdD           DYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIV---LVGTKLDLRDDKQFFIDH
3cueF           TVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDL
1e9sH           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYA----LSVVPRGKTDEAEEWASYGRLLLRETAKK
1e2iA           TQHRLDQGEISAGDAAVVMAQITMGMPYAVTDAVLAPHIGGEAGPPALTLIFDRHPIAALLCYPAARYLM
2ahvA           GDRADAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTLRAAISDIGIGTFVDPRQQGGKL
2d7vB           HLAHENCFI-------------------------------------------------------------
1e9rG           GRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTP
1cjtC           AAMLVPPVELANPEN---QFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQ
1e9rF           GRDKDIILNPYDQR--TKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAE-----EWASYGRLLLRETAKK
2dr3F           PGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKS---------KEYEKYIVHDLTDI
1e9sA           SKFGRDKDIILNPYDQRTKGWSFFN----EIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
3ed8A           NTPIGDGPVLLPDNHYLSYQTVLS----------------------------------------------
1av6A           DPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISD---VRSPSTADLLSNYALQNVMISILNPVAS
1akeA           KSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEF
2e85A           --------------------SAVTDVLLCV-------GNSMMGDDGAGPLLAE--KCAAAPKGNWVVIDG
2a1fE           --------------------------------------------------------------------SQ
2ancF           DVFLDIDWQMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTA
1ckvA           ----------------------------------------------------------------------
3b85B           GEKLGFLPDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYR--------GRTLNDAFVILDEAQNTTP
3bb1H           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFG
3d3qB           TTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGT-GLYIQSLLYNYAFEDKKQVK
2d2fA           ELSPDERFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALEL--LDWDESYLSRYLNEGFSG
2dpyB           NILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAED--FRDRGQHVLLIMDSLTRYAMAQREIALAIG
1chdA           ----------------------------------------------------------------------
3bm2B           -----------------NRRSASRLAEPAPTGEQLQLRAGRAPDWHFFVIEGEGRERFSAVLEQGAIAAG
1bccF           KWYYNAAGFNKYGLMRDD--TIYENDDVKEAIRRLPENLYDDRMFRIKR-------ALDLNMRQQILPKE
2awoD           PPAERGVGMVEPSVFLLDEPLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVA
2dftC           SIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGGGDRAE
3bb1G           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVVDRLDAYRVDNLDKLVAKAITDSFGKGI
1cs4C           AIAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQ
1e2jA           TIANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGGSPPPALTLIFDRHPIAALL
3a00B           GEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASV--------------KQVSKSGKTCILD
1e2mB           TIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSLTLIFDRHPIAALLCY
1accA           NGNLQYQGKDITEFDFNFDQQTSQNIKNQLA----------ELNATNIYTVLDKIKLNAILIRDKRFHYD
2bhvC           -LITPISSQIAGKVIA----QVES------------------DIFAHMGKAVLIPKGSKVIGYYSNNNKM
1e4vA           GSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG---FLLDGFPRTIPQADAMKEAGINVDYVLE
2a1fC           --------------------------------------------------------------------SQ
1culC           TIVMSNLVPPVELA---NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLID
3cqcA           LEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKM-----Y
2dr3C           QFLWNGLKMGEPGIYVALEEHPVQV-RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEYEKYIVHDLTDI
1e9sI           --RMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTD---------
3cmuA           PIYARKLGVDIDNLLCSQPDTGEQALEICDAL-----ARSGAVD----VIVVDSVAALTPKAEIEGEGDS
1e2nB           ETITQHRLDQGEISAGDAAVVMTSAQITMGMPYA-VTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCY
1e9sL           GRDKDIILNPYDQRKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
1e9sE           GRDKDIILNPYDQR--TKGWSFFNEIRNDYDWQRYALSVVPRGKTDEA--------EEWASYGRLLLRET
3b9qA           AASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEE---------
1dvrA           LEAKKIMDQGGLVSDDIMVNMIKDELT--NNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIEL
2ancB           PGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYY-----GTSREAIEQVLATGVDVFLDIDWQGAQQ
2c9gA           ----------------------------------------------------------------------
2b8tD           SLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFG
3a00A           GEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQ--------------VSKSGKTCILD
2anbA           -----PGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQ
2an9A           TRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQ
3c7kC           KQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRME-------DTEPFSAELLSAMM
1e2mA           ETIANIYTTQHRLDQGEISAGDAAVV---MTSAQITMGMPYAVTDAV------------LAPHIGGEAGS
1e2lB           LGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPP------ALT
3bb1D           GFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDDNLDKLVAKAITDSFGKGIWYDEFFSKRSEALLQ
3ec1A           DMISGATLYDTPGII---NHHQMAHFVDARDLKIITPKRE---IHPRVYQLNEGQTLFFGGLARLDYIKG
1e1qB           KRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLYSGCSMGEYFRDNGKHALIIYDDLSKLRRPPGR
1c9kC           RPAHWRTARHLDTLI--TADLAPDDA--------ILLECITTMVTNLLFALGDPEQWDYAAME-----RA
2cdnA           GTKLGVEAKRYLDAGDLVPSLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLE
2c9oA           EIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCHVIIGLKTAKGTKQLKLDPSIFESLQKERV---
2b0lC           ----------------------------------------------------------------------
1e9rB           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDY----DWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
2dpyA           NILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAED--FRDRGQHVLLIMDSLTRYAMAQREIALAIG
2ancD           PGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATG-----VDVFLDIDWQGAQQ
3dvlC           ---PQDIIKNARSFGWDLAK----------LVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQK
1e2lA           IFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYA--------VTDAVLAPHIGGEAGSPPPALRHPIAAL
1eamA           ---GRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILN
3e70C           -----GFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAG
3cmwC           ARKLGVDIDNLLCS---QPDTGEQ----------------------------------------------
1cjuC           ETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYER--------
1ek0A           HTVKFEIWDTAGQERFASLAPYYRNAQAAVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDLQE
3dofB           ----------------------------------------------------------------------
1e2hA           IYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEALTLIFDRHPIAALLCYPAARYL
3c85A           RARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVLVLLAPHHQGNQTALEQLQRRN
3cddA           TVDIRVITGYVDDWVPSYDESTITISVSGRDKT-ADLVDCNQTLTQIADIVCKPFGIKVIVNTDVGEIEQ
3bjqB           ----------------------------------------------------------------------
3dfdA           REAYKTEDPVEVAKRVL---SVGGEYANWLNKA----IEINGFD--------------------------
2ekbA           ------------------------------------------------------AGFSPRLYPELREIHF
2ax4B           GLNIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFVDAPLNICESRDVKGLYKRARAG


                         +         .         .         .         .         *         .:210
query           GQKQRAVIARMFASDPDVFILDEPTTGMDAGSKNEFYELMHHSAHHHGKAVLMITHDPEEVKDYADRNIH
3b5jA           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHK--ICKGRTVIIIAHRLSTVK-NADRIIV
2ccgB           ARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEKVIEGEIIHNESQRFKS
2c03B           RLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSAR
2dwoA           TTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEV-KISSPDYKDCNSAEAMDDFMKRISCYEAS
3dmdC           RSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSIS
1e69A           GEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKE--NSKHTQFIVITHNKIVM-EAADLLHG
2czvA           YERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLG----VVIGMEIPQAKASISMY---PEI---
3cmvH           SQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIG-AVKEGENVVGSETRVKVVKNKIAAPFK
2d3wB           GEKKRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSL--RDGKRSFIIVTHYRILDYIKPDYVHV
3b60A           GQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDE--LQKNRTSLVIAHRLSTIE-QAD----
2ccgA           ARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKN-SRDQNRLDQEDLKFHEKVIEGYQEIIH
3eiuA           AKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL------HRKGIYPPINVLPSLSRLMNSGIG
3dm5A           RHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAV
1e9cA           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ-----ERALRCFHQLMKDTTLNWKM
3cmvG           AMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAE
2dwpA           TTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEV-KISSPDYKDCNSAEAMDDFMKRISCYEAS
2ccjB           ARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKN-NRLDQEDLKFHEKVIEGYQEIIQRFKS
2c03A           RLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSAR
2bifA           TTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIV-QVKLGSPDYVNRDSDEATEDFMRRIECYENS
3dmdB           RSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSIS
3b2qA           EALRQMGAARN---EVPGRRGYPGYMYTDLATLYERAGIVKG--AKGSVTQIPILSMPGDDITHPIPDLS
1aroP           MFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQE-IKPEAVAYITIKTTLACLTSADNTTVQ
1d1cA           GATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKIT---RQAMDIVGFSQEEQMSIFKIIAGILH
3cmvC           AMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVENVVGSETRVKVVKNKIAAPFKQAEFQI
2b8tA           PIAKLFTYADKITKLTAICNECGAEATH-------SLRKIDGKHADYNDDIVKIGCQ-EFYSAVCRHHHK
1bifA           TTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLG-SPDYVNRDSDEATEDFMRRIEC--YE
2axzC           SIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQFEHLKTIKNISINGYYDLEINY-LKQIYQF
1e0jB           AYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGR
2awnC           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
1e9fA           SLDWCKQPDVGLPKPDLVLFLQLQLAD------------AAKRYENGAFQERALRCFHQLMKDTTLNWKM
2c04A           RLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSAR
2akaB           IEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEV--DPQGQRTIGVITKLDLMDEGTDARDV
3cmvA           DVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLD
2c61B           AKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL------HRKGIYPPINVLPSLSRLMNSGI-
1e98A           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAF-----GHERYENGAFQERALRCFHQLMKDTTLNWKM
2bbsA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKT--RILVTSKMEHLKKADKILI
2a5gA           MKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWL------------------------------
3b85A           GFGSKVVTGDGLRLVRHI-LRGVDDVHFSELTSSD-----------------------------------
1e0jA           AYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGR
2b8wA           FVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKL
1dhjA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYL
3d3kA           QPWYKAAVAWANQNRAPVLSID-PPVHIDAKWSLALGLPLPLGEHAG-RIYLCDIGIPQQVFQEVGINYH
2a2zD           WHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILT
1bg0A           ATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNVWVNEEDHLRIISMQKGGDLKTVYKRLVTAVD
2d0kA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAAGDVPEIFVIGGGRVYEQFLPKAQKLYL
2cckA           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSGRERIIKNSRLDQEDLKFHEKVIEGYQEIIRFKSV
1cr4A           DRLLAKLAYMRSGLGCDVIILDHISIRKM---IDNLMTKLKGFAKSTGVVLVVICHLKGALRQLSDTIIA
1e2dA           LDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE------RALRCFHQLMKDTTLNWKM
3b2qB           AKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRKGI------YPPINVLPSLSRLMNSGIG
3c95A           AEQQRWLEHRRQVFTPE--FLQGYADELQMLVQQYADDKLLKALWQYADEIV------------------
1e3mB           TFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWCAENLANKIKALTLFATHYFELTQLPEKEGVA
1e9dA           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG-----HERYENGAFQERALRCFHQLMKDTTLNWKM
1e9rA           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS
3dt2A           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGGRRPAGVPLVYEALSWQHGVFVG-----
2awnB           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
3d7wA           PGGQTKTQARSIL--ILIQMISEAARFNPI--LWRARQYI-----NSGASFLPDVYMLELETSWGQQSTQ
3dt4C           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVIIFGGRRPAGVPLVYEALSWQHGVFVG-----
2cjwB           GRAAVVFDCKFIETSAAVQHNVK--------------------ELFEGIVRQVRLRRDSKEK-NERRLAY
3dtbB           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIFGGRRPAGVPLVYEALSWQHGV-FVGAAMR
2d62A           GQRQRVALGRAIIRRPKVFL-DEPLSNLDAKLRVKRAELKKL-QRQLGVTTIYVTHDQVEATG-------
2dr3A           REFIEVLRQAIRDINAKRVVVDSVTTLYINKPARSIILQLKRVLAGTGCTSIFVSQVSGFGPHGVDGIIR
2awnD           GRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLG
2ctsA           MSQLSAAITALNSESNFARAYAEGIHRTKYWELIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKL
2a30D           WHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILT
3a1wA           TAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ-------------------------
3eiuB           AKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVA------RELHRKGIYPPINVLPSLSRLMNSGIG
3cr7C           VIKEFTGISAPYE-APANPEVHVKNYELPV--QDAVKQIID-----------------------------
2dr3B           REFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGVE
1dkiA           SRVQRALKENFGYNQSVHQINRGDFSKQ-------DWEAQIDKELSQNQPVYYQGVG-------------
4dcgA           GNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYMYYLNKIVRNKVVVNFDYPNQEYDYFHMYF
3da4A           KEYQILLPGEIHIKES------------------------------------------------------
1e9sG           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTM-PDGDFSIRSWLED
2cckB           INGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIRFKSVNADQPLENVVEDTYQTII
3czpB           QTQER-FKEREKTPYKRYKITEEDWRNRD--KWDQYVDAVWTLVEANDKRVKVLRTINDAI-EAAYK---
2axpA           KDIDSILELYREVSNAGLHTYSWDTGQWSSDEIIFLVELEHHHHHH------------------------
2bc9A           INQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEPLTPDEYLTYSLKLKKGTSQKDETFN
2bhjA           ATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDFR
2a30B           DWHDWMNNQGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILT
1e9sF           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLSLFAGSNEASKALTSARFV
3bgwA           IWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQIARELDVVVIALSQLSRQVEQRQDKRPM
2cgtH           YFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVK
3bgwD           QTKRKNPGKRVIVMIDYLQLLEPAKANSRTNQISQISRDLKKMARELDVVVIALSQLSRQVEQRQDKRPM
3dt4A           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGGIIFGGRRPAGVPLVYEALSWQHGVFVG-----
3dauA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYL
3b55A           SLNDL--KPLKNVGSASIVGLGEATHGAHEVFTKHR--IVKYLVSEKGFTNLVLEEGWDRALELDRY---
1e9sD           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGAESLFAGSNEASKALTSA---
5dfrA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYL
421pA           LAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH-----------------------
3czpA           QTQER-FKEREKTPYKRYKITEEDWRNRDRTSTEIAPWTLVEANDKRFARVKVLRTINDAI-EAAYKK--
2c9yA           SIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRR---SDDNEKALKIRLQAYHTQTT
2c61A           AEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPD------
1dhiA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYL
3cm0A           EVPEEELVRRILRREGRSDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRAALG
3dfoD           QKKELSDIAHRIVAPGKGILAANESTSIAKRLQSIGTENTEE--NRRFYRQLLLTADDRVNPCIGGVILF
2a2zA           MNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWL
3cmvE           AMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAE
2d4uA           ALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAV-SDNN--------------
3bpbA           AILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSK-PEFQDFNIIEIPEEE----SYAANCIW
1dg3A           FFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKK-------------
3adkA           DAGPETMTKRLLKRGETSGRVDDNEETIKKRLE-TYYKATEPVIAFYEKRGIVRKVNVDDV---FSQVCT
1e9sB           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS
3bh0A           QTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISDLKKMARELDVVVIALSQLSRQVEQRQDKRPM
2dflA           DPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVMHTLYHVPGIRIQ
1e3aB           SDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSM-LKRTVVAAVPMPFDKWYSASGYETTQD
3cr7D           VIKEFTGISAPYE-APANPEVHVKNYELPV--QDAVKQIID-----------------------------
3czjA           ATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAIT
2awoA           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
3dfnA           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTE-ENRRFYRQLLLTADDRVNPCIGGVILF
3dfqA           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILF
3bjdB           ALEQEIAAQSRERHPSQYFSGSASRAQLQVFLRHQWFRTFRL--YRDAADLLVNLTDVDEAA-ALARYLY
3dfnC           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGT-ENTEENRRFYRQLLLTADDRVNPCIGGVILF
1e3mA           GFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWCAENLANKIKALTLFATHYFELTQLPEKEGVA
3dftD           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRF-YRQLLLTADDRVNPCIGGVILF
2d4hA           ESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLTFNLPRLCIRKFFPKKKCFVFDRPVHRRKL
3dfqD           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTE-ENRRFYRQLLLTADDRVNPCIGGVILF
3dfpD           QKKELSDIAHRIVAPGKGILAANESTSIAKRLQSIGTENTEE--NRRFYRQLLLTADDRVNPCIGGVILF
3bo6B           NTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNE---LRSGRDGGEMQSQALREEPFYRL---
2bdtA           RKKGERCLEL--VEEFESKGIDERYFYNTSHLQPTNLNDI-VKNLKTNPRFI------------------
1cr1A           ETDRLLAKLAYMRSGCDVIILDHIS---IRKMIDNLMTKLKGFAKSTGVVLVVICHGSGALRQLSDTIIA
2drcA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYL
1aldA           QKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTE-ENRRFYRQLLLTADDRVNPCIGGVILF
2boeX           QVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQ
3dftC           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTE-ENRRFYRQLLLTADDRVNPCIGGVILF
2c9oC           DIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKI
1cfrA           NPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELEHIKSFLSVKTTF-RPDRRLQ
2a5jA           ESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL------------------
1e9sJ           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGAESLFAGSNEASKALTSARFV
1cr2A           DRLLAKLAYMRSGLGCDVIILDHISIRKMI---DNLMTKLKGFAKSTGVVLVVICHLKSGARQLSDTIIA
1e2fA           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE-----RALRCFHQLMKDTTLNWKM
3dfpC           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGT-ENTEENRRFYRQLLLTADDRVNPCIGGVILF
3cmxA           PETTTGGNALKFYASV-RLDIRRIGAVKEGENVVGSETRVKVVKN------KIAAPFKQAEFQILYG---
2c0bL           FSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINTNLEAADEIARQLRLRDLGGVIDFIDMTPV
3cr7A           VIKEFTGISAPEAPANPEVHVKNYELPVQDAVKQIIDYLD------------------------------
3dhwC           GQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAV
1draA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYL
2a30A           WHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILT
3c8uA           GAAEVGPECRVAIIEGNYLLFDAPGWRDAIWDVSIRLEVPADLEARLVQRWLDHGLNHDAAVARAQGNDL
3cddF           GIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSI--GKSNAEYTVTGWRIPQTG-KLWN---
2c7cH           YFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVK
2b92B           FFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRK
3dyoA           ATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAIT
2a2zB           WHDWMNNQFGQSLELDGIIYLQATPLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILT
2bbsB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIF--ESCVCKLMANKTRILVTSKMEHLKKADKILI
2d4uB           ALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYM------------------------------
1e9rE           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFLRGFLEGTLAESLFAGSNEASKALTSARFV
3dt7A           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVIIFGGRRPAGVPLVYEALSWQHGVFVG-----
3dlbB           LQGREGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAV
1e2iB           GEAHAPPPALTLIFDRHPIALCYPAARYLMGSMTAVLAFVLIPPTLPGTNIVLGALPEDRHIDRLAK---
1e4yA           TIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDV---TGEELTT
3dymA           SEATRIDPNAERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAIT
3d1mA           KITRNSERFKTPNYNPDIIFKDEENTGADRLMTQRCKDKLSVMNQWPGVKLRVTEGWDEDGHHSEES---
3cbnA           DHPTDIVCRKSDYICSRTLIRADKAAFDL---DENLVRDL------RKGRELKVEIIVEYEGHH------
2b8tB           PIAKLFTYADKITKLTAICNECGAEATHSLRKIDG--------KHADYNDDIVKIGCQEFYSAVCRH---
1drbA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYL
2bbtB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE-SCVCKLMANKTRILVTSKM-EHLKKADKILI
3cddD           GETPHELLARL-AKQRGVLLTSDTFGNLVITRAS---KTKAGVSLILGDNVKAARGRFSQRFSKFTIKDS
2dr3E           REFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIQLKRVLAGTGCTSIFVVSVGPGVEHGVDGIIR
3dfnD           QKKELSDIAHRIVAPGKGILAANESTGSIAKRL-QSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
6aldA           QKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTE-ENRRFYRQLLLTADDRVNPCIGGVILF
1bmfC           YSGCSMGEYFRDNGKHALIIYDDLSKQAVA--YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDA
1dyhA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYL
3bb1B           WNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL-ASDIPVVLIENSGRCNSDEKVLPNGIA
2bkiA           ASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAM
1cjaA           GYDVG--TEGSISMQEGFLATVRECASFDLDAFERELLSWQHNLSISPQAIPFILRM-------------
3dfqC           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTE-ENRRFYRQLLLTADDRVNPCIGGVILF
1e9rD           --EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDRGFLEGTLAESLFAGSNEASKALTSARFV
2akaA           ATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKIT----RQAMDIVGFSQEEQMSIFKIIAGILH
2bhvA           GEYRDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGTSAFGDYLLMQLMRQSGMGINQVVNQ---
2d4hB           QPLTPDEYIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELD-PEFVQQVADFCSYIFSNSKTKTLSGGI
2bjbA           DGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEPDLTNAVAFLSA---
1dp0A           ATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAIT
3d31A           GEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARIMADRIAV
2d3wD           GEKKRNDILQMAVLEPELCILDESDGLDID--ALKVVADGVNSLRDGKRSFIIVTHYQRILYIKPDYVHV
4dfrA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYL
2e85B           GSAPENDIVAIRELRPTLLIVDATDMGLNPGE------IRIIDPDDIAEMFMMTTHNMPLN---------
2bkhA           ASEDIRERLHLSPDNFRYLNRGCTRYFANKETDKQILQNRSPEYLKAGSLKDPLLDDHGDFIRMCTAMKK
2awoC           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
3dm9B           AGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSI-
1d6jB           DVPVEVAEQRAPYEAPANPEVHVKNYELPV----------------------------------------
1e6cA           TGRPIAEEMEAVLREREALYQDVAHYVVDATQPPA-----------------------------------
2b8tC           PIAKLFTYADKITKLTAICNECGAEATHSLRKIDGK--------HADYNDDIVKIGCQEFYSAVCRHHHK
2czvB           YERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIGMEIPQAKASISMYPEII---------
1eilA           GSAGDAALYRADQRAWRIAVQPGELDDLAYGLEVDDAAALERMADKLRQAGVAFTRGDEA--LMQQRKVM
3bb1A           WNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL--KSDIPVVLIENSGRCNKNDSDEK---
1bglA           ATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQM---
2eg5G           SKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLT----CICKGVELDARNAIDLLEMAINDLVV
2d2eA           GEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVHV
3dffA           LPDGRWLTAHVEGRQKLAVNDHSPDSDHD--LVGEVADDIRSIIDEFDPTLVVTCAAIGE---HPDHEAT
2ck3C           YSGCSMGEYFRDNGKHALIIYDDLSKQAVA--YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDA
3dfoC           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGT-ENTEENRRFYRQLLLTADDRVNPCIGGVILF
2b8wB           TELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKF
1cr0A           ETDRLLAKLAYMRLGCDVIILDHISIRKMI---DNLMTKLKGFAKSTGVVLVVICHDLRALRQLSDTIIA
1adoA           QKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTE-ENRRFYRQLLLTADDRVNPCIGGVILF
2c4rL           FSHYQIESQIESAFQREGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIARQLRLRDLGGLIVI
2a1fF           PIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEI-KELVEMGVEVSVVLGGGNLFRGAKLAKAG
1e2kA           EAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFIPPTLPGTNIVLGALPEDRHIDRLAKRQ-
1e9sM           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS
3bb1F           WNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL--KKDIPVVLIENSGRCNKNDSDEK---
3bv4A           QKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTE-ENRRFYRQLLLTADDRVNPCIGGVILF
3clvA           DKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYML------------------------------
3bb1E           WNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRS-GASLKKASDIPVVLIENSGRCNK-NDSDEKV
3cr7B           DPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYL------------------
2bwjA           DCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLE-AYYRASIPVIAYYETKTQLHKINAEGTPEDLQL---
2d3wA           GEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHV
3bb1C           WNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL--KSDIPVVLIENSGRCNKNDSDEK---
2ausC           EVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVV-QALLPAGKEYVALMHLHGDV-PEDKIRAV
3ch4B           VDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRS----------------------------
1ak2A           SIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGPLIRRSDDNKKALKIRLEAYHTQTTPLVE
3cnnA           GVPDIERALMLFFTEAGRVSFERPE---------------------------------------------
3cmvB           AMRKLAGNLKQSN-TLLIFINQGGNALKFYASVRLDIRRIGA--VKEGENVVGSETRVKVVKNKIAA---
2aunB           TVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWG-RLEAASPRPLIGFSDISVLLSAFHRHGLP
3cnlA           GVPDIERALMLFFTEAGRVSFERPE---------------------------------------------
3ecpA           GAMQT----VKLAQEFPELLAIEDTTSLSYRHQVAEELGKLG--SIQDKSRGWWVHSVLLLEATTFRTVG
1e2hB           ARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRYLQ
1e59A           DERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILP-RMKSGERVIIAAHGN-SLRALVKYLDN
3cmtD           KNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSET-----RVKVVKNKIAAPFKQAEFQILYG---
3d3qA           KEEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLKKVQQFTENYDTLLIGIESRETLYLRINKRVDI
3bk7A           GELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRLIV
2cvfA           RKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKP-GLRVAVLERHRFRPEGLMAY---
1ai4B           SDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSM-LKRTVVAAVPMPFDKWYSASGYETTQD
2bhvD           GYRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPTFGDYLLMQLMRQSGMGINQVVNQILR
2aumA           TVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGL--DWGRLEAASPRPLIGFA-----DISVLLSAF
2dr3D           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGVE
1b0uA           GQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLR-IMQQLAEEGKTMVVVTHEMGFARHVSSHVIF
2bv7A           GWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKV-RLFLVNYTATIDVIYEMYTRMNAEL----
1d8jA           GLKQKQWLMEALVNNPKIEVIDGKYAFKPKYN--------------------------------------
1afrA           IYTSFQERATFISHGNTARQAKEHGDIKLA-------QICGTIAADEKRHETAYTKIVEKLFEIDPDGTV
3cddC           GETPHELLARL-AKQRGVLLTSDTFGNLVITRASKTKAGVS---LILGDNVKAARGRFS-----------
1e2kB           GEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
3d1mB           KITRNSERFKTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVWPGVKLRVTEGWDEDGHHSEESL
2bx2L           FSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINS---ARGDIEETAFNTNLEAADEIARQLRL
3bczC           SIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFVSSDFCHWGQRFRYSYYDESQGEIYRSIEH
2d3wC           GEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIV--THYQR-ILDYIKPDYVHV
2aumB           TVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRL--EAASPRPLIGFADISVLLSAFHRHGL
3be4A           GRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAPLVKFYEDLGIL-KR
2bofX           AYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSS-------------
1e2nA           PIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGNIVLGALPEDRHIDRLAKRQRPGERLD-------
3cioD           PPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQ-AGVNIKGAIGVIKRASTAYSYG-----
3brwA           KLGATSEEELFST-NEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTGTESVYCNFRNKEIMFHVSTKL-
2bkeA           DPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVVPGIRIQLK----
4atjA           GPSWRVPLGRRDSLQLANANLPAPFFTLPQLKDSFRNVGL-NRSSDLVALSGGHTFGKNQCRFIMDR---
3di4A           HEAELVHDVLNVFCTGGQYFKASPVRPGDYLEFFAEIDLLGSACPGGDCSSEASCHPLLVEIFAPAE---
2a1fD           PIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVE-IKELVEMGVEVSVVLGGGNLFRGAKLAKAG
1d6jA           GEETGLPFVEVYVDVPVEAPYEAPANPEV-----------------------------------------
3dvlD           YRARRVSI--------DSVTSVFQQYDASSVVRRELFRLVAR-LKQIGATTVMTTERIEEYGPIARYGVE
2ahwD           NEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALV--------------
1e2gA           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAFQ---------ERALRCFHQLMKDTTLNWKM
2bbtA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVC--KLMANKTRILVTSKMEHLKKADKILI
3dm5B           GRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAV
2d7vA           ----------------------------------------------------------------------
2c5mD           --KSCGLHVTSIKIDP-YINIDAGLTKDNNLTTGKIYQYKERKGDYLGKTVQVVPHITDAIQEWVMRQAL
2awnA           ---------RTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2dftA           KYRALMAKRAPLYRRVATMRVDTNRRNPGA----------------------------------------
1dekB           KSPIKGVFVFDDE-GKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFAL---
3crmA           EGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVHARSDLHAGLPSIRAVGYRQVWDYLDGKL-
2aexA           --------------EDELAHRCSSFMAPPVTDLGELRRRPGDMKTKVCQALAQVDGGANFSVDRWER-KE
1dekA           INNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGAT
2ccjA           ARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFHEKVIEGYQEIIHRFKS
3bwdD           AVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAI------------------------------
3cueF           KDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTM------------------------------
1e9sH           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS
1e2iA           GSMTPQAVLAFVALIPPTLPGTNIVL-GALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLANTVRY
2ahvA           NEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATCDSEGYATFEDEVMYLDALVIAQAVHNNGGIV---
2d7vB           ----------------------------------------------------------------------
1e9rG           SMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLED
1cjtC           YFLDKIDVIKQDDYVPS-DQDLLRCRVLTSGIFETKFQ--------------------------------
1e9rF           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS
2dr3F           REFIEVLRQAIRDINAKRVVVDSVTTLYINKPARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVEHGVDG
1e9sA           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS
3ed8A           ----------------------------------------------------------------------
1av6A           SLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIY-TGENMRLTRVTKSDAVNYEKKMYYLNK
1akeA           DVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELEYHQMTAPLIGYYSKEAEAGNTKYAK
2e85A           GSAPENDIVAIRELRPTRLLIVDA---TDMGLNPGEIRIIDP--DDIAEMFMMTTHNMPLNQLKEDIGEV
2a1fE           PIYKRILLK-----LSGEALQGEDGLGIDPAILDRMAVEIKE-LVEMGVEVSVVLGGGNLFRGAKLAKAG
2ancF           LTDLKTIIRERLRMSRQKQRHDALISKLLA----------------------------------------
1ckvA           ----------------------------------------------------------------------
3b85B           AQKFL----TRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSDVVRHQLVGHIVDAY---------
3bb1H           KGIWNKALTHAQFSPPDGLPYDE------FFSKRSEALLQVVRSGASLKKDSD-----------------
3d3qB           LKKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIQQFTENYDTLLIGIESRETLYLRINKR---
2d2fA           GEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVHV
2dpyB           EPPATKGYPPSVFAKLPALVERAGNGIHGGGS--------------------------------------
1chdA           ------------LSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITQHMPPGFTRSFAERLNK
3bm2B           SDDKAIDKARNAPFRAPLIITVVAKVPRW-----------------------------------------
1bccF           QWTKYEEDVPYLEPYLKEVI--------------------------------------------------
2awoD           QVGKPLELYHYPADRFVAGFIGSPKMFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLG
2dftC           KYRALMAKRAPLYRRVATMRVDTNRRNPGA----------------------------------------
3bb1G           WNKAIVALTHAQFSPPDGLPYDEFFSKRSE----ALLQVVRSGASLSDIPVVLIENSGRCNK-NDSDEKV
1cs4C           YFLDKIDVIKQDDYVPS-DQDLLRCRVLTSGIFETKFQVDKVNFHMF-----------------------
1e2jA           CYPAARYLMGSMTPQAVLAFVALIIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLANTVRY
3a00B           IDMQGVKSVKAIPELNARFLFIAPPSGAH----DKVIVNDDLDKAYKELKDFIFAE--------------
1e2mB           PAARYLMMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRYLQ
1accA           RNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKI------LSGYIVEIEDTEGLKE-VINDRYDM
2bhvC           EYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRY------------------------------
1e4vA           FDVPDELIVDRIVGRRVHAPSGRVYHVLTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAK
2a1fC           PIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKE-LVEMGVEVSVVLGGGNLFRGAKLA---
1culC           CAQYFLKIDVIKQDDYVPSDQDLLCRVLTSGIF-------------------------------------
3cqcA           NVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFLLHT-----ILHSTGQYQECLQLADM---
2dr3C           REFIEVLRQAIRDINAKRVVVDSVTTLYIPAMARSIILQLKRVLAGTGCTSIFVSQVSGVEHGV-DGIIR
1e9sI           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESAGSNEASKALTSARFV
3cmuA           HMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFG--NPETTTGGNALKFYASV---------
1e2nB           PAARYLMMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR-LAKLDLAMLAAIRR--VYGLLANTVRY
1e9sL           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTM--------------
1e9sE           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAS-----------------------
3b9qA           LIACKKAVGKIV-----SGAPNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVV---
1dvrA           KVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDTGEALVQISDDNADALKKRLAAYHAQTEPIVD
2ancB           IRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAEMSHYAEYDYLIVNDDFDTALTDLKTIIR
2c9gA           ----------------------------------------------------------------------
2b8tD           PIAKLFTYADKITKLTAICNECGAEATH-------SLRKIDGKHADYNDDIVKIGCQE-FYSAVCRHHHK
3a00A           IDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKA--YKELKDFIFAE--------------
2anbA           IRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQMSHYAEYDYLIVNDDFDTALTDLKTIIR
2an9A           IRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIR
3c7kC           RLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRL
1e2mA           PPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRP
1e2lB           LIFDRHPIA-------ALLCYPAARYLMGSMTPQAVLAFVALPPTLPGTNIVLGALPEDRHIDRLAKRLD
3bb1D           VVRSGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPH--LVQTITEVALNKSESIFVD-KNL---
3ec1A           GRRSFVCYMANELTVHRTKL-EKADSLYANQLGELLSPPSK---RYAAEFPPLVPRSLS-----------
1e1qB           EAYPGDVFYLHSRLLERAAKMNDAFGGGS-----------------------------------------
1c9kC           IDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRAADEVWLVVSGGVKIK--------
2cdnA           FRVSEEVLLERLKGRGRADDTDDVILNRMK----VYRDETAPLLEYYRDQLKTVDGTMDEV---------
2c9oA           EAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANGEINKVVN
2b0lC           -------------SKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVVIVNALRKLESAGV
1e9rB           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS
2dpyA           --------------EPPATKGYPPSVFAKLPA---LVERAGNGIHGGGSTVLTEGDDADSARAILDGHIV
2ancD           IRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAEMSHYAEYDYLIVNDDFDTALTDLKTIIR
3dvlC           YRARRVSID----SVTSVFQQYD----ASSVVRRELFRLVAR-LKQIGATTVMTTERIEEYGPIAR----
1e2lA           LCYPAARYLMGSMTPQAVLAFVALIPPT------------------------------------------
1eamA           PVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYAKKMYY
3e70C           RSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSIS
3cmwC           ----------------------------------------------------------------------
1cjuC           -SNEYQLIDCAQYFLDKIDVIKQDDYVPSDQDLLRCRVLTSGIFETKVDKVNFHMFDVGGQRDERRKWIQ
1ek0A           GGERK-----------------------------------------------------------------
3dofB           -------------GYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLYTPIFNEYISLVEKYIEEQLLQ
1e2hA           MGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLANTVRY
3c85A           YKGQIAAIAEYPD-QLEGLLESGVDAAFN-----------------------------------------
3cddA           GETPHELLARL-AKQRGVLLTSDTFSKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIKAAKDVTDSEIG
3bjqB           ----------------DPILSTHARGYRQSTLIGKKLFPVAP-VAQYGGKILTFGKEAFRLYNTKRNTKR
3dfdA           ----------------------------------------------------------------------
2ekbA           GALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGG------------
2ax4B           EIKGFTGIDSDYPETPERVL---KTNLST-----------------------------------------


                         .         .         .         +         .         .         .:280
query           LVRNQDSPWRCFNVHENGQEVGHA
3b5jA           M-----------------------
2ccgB           VNADQ-------------------
2c03B           HVTGK-------------------
2dwoA           YQPLDPDKCDRDLSLIKV------
3dmdC           YVIDA-------------------
1e69A           VT----------------------
2czvA           ------------------------
3cmvH           QAE---------------------
2d3wB           L-----------------------
3b60A           ------------------------
2ccgA           N-----------------------
3eiuA           A-----------------------
3dm5A           AATGA-------------------
1e9cA           VDASK-------------------
3cmvG           FGEGINFYGELVD-----------
2dwpA           YQPLDPDKC---------------
2ccjB           V-----------------------
2c03A           HVTG--------------------
2bifA           YESLDEEQDRDLSYIKI-------
3dmdB           YVIDA-------------------
3b2qA           GYITEGQIVVARELHRKGI-----
1aroP           AVASA-------------------
1d1cA           ------------------------
3cmvC           L-----------------------
2b8tA           V-----------------------
1bifA           NSYESLDEEQDRDLSYIKIMDVG-
2axzC           L-----------------------
1e0jB           ------------------------
2awnC           LVAQVGKPLELYH-----------
1e9fA           VDASKS------------------
2c04A           HVTG--------------------
2akaB           L-----------------------
3cmvA           ------------------------
2c61B           ------------------------
1e98A           VDASK-------------------
2bbsA           ------------------------
2a5gA           ------------------------
3b85A           ------------------------
1e0jA           PVSITD------------------
2b8wA           ------------------------
1dhjA           T-----------------------
3d3kA           S-----------------------
2a2zD           LDVNED------------------
1bg0A           ------------------------
2d0kA           T-----------------------
2cckA           N-----------------------
1cr4A           LERNQ-------------------
1e2dA           VDASK-------------------
3b2qB           A-----------------------
3c95A           ------------------------
1e3mB           NVH---------------------
1e9dA           VDASK-------------------
1e9rA           IRSWLEDPNGGNLFI---------
3dt2A           ------------------------
2awnB           L-----------------------
3d7wA           VQHSTDGVFNNP------------
3dt4C           ------------------------
2cjwB           Q-----------------------
3dtbB           SEAKVIMHD---------------
2d62A           ------------------------
2dr3A           L-----------------------
2awnD           ------------------------
2ctsA           DWSHNFTNMLGYTDA---------
2a30D           L-----------------------
3a1wA           ------------------------
3eiuB           ------------------------
3cr7C           ------------------------
2dr3B           HGVD--------------------
1dkiA           ------------------------
4dcgA           ML----------------------
3da4A           ------------------------
1e9sG           PNGGNLFITWREDMGPALR-----
2cckB           ------------------------
3czpB           ------------------------
2axpA           ------------------------
2bc9A           LPRLCIRKFFPK------------
2bhjA           LWNSQLIRYAGYQMPDGTIRG---
2a30B           L-----------------------
1e9sF           L-----------------------
3bgwA           LSDLRESGQLEQDADI--------
2cgtH           VAAVKAPGFGD-------------
3bgwD           LSDLRESGQLEQDADI--------
3dt4A           ------------------------
3dauA           T-----------------------
3b55A           ------------------------
1e9sD           ------------------------
5dfrA           T-----------------------
421pA           ------------------------
3czpA           ------------------------
2c9yA           PLIEY-------------------
2c61A           ------------------------
1dhiA           T-----------------------
3cm0A           I-----------------------
3dfoD           H-----------------------
2a2zA           LHRTLK------------------
3cmvE           FGEGINFYGELVDLGVKEKLIEK-
2d4uA           ------------------------
3bpbA           VNERV--IMPAGYPRTREKIARL-
1dg3A           ------------------------
3adkA           HLDT--------------------
1e9sB           IRSWLEDPNGGNLFI---------
3bh0A           ------------------------
2dflA           L-----------------------
1e3aB           GPT---------------------
3cr7D           ------------------------
3czjA           VDVEVASDTPHPARI---------
2awoA           ------------------------
3dfnA           H-----------------------
3dfqA           H-----------------------
3bjdB           GELGE-------------------
3dfnC           H-----------------------
1e3mA           N-----------------------
3dftD           H-----------------------
2d4hA           A-----------------------
3dfqD           H-----------------------
3dfpD           H-----------------------
3bo6B           ------------------------
2bdtA           ------------------------
1cr1A           LERNQ-------------------
2drcA           T-----------------------
1aldA           H-----------------------
2boeX           E-----------------------
3dftC           H-----------------------
2c9oC           RAQ---------------------
1cfrA           LAHEGSLMK---------------
2a5jA           ------------------------
1e9sJ           L-----------------------
1cr2A           LERNN-------------------
1e2fA           VDASK-------------------
3dfpC           H-----------------------
3cmxA           ------------------------
2c0bL           ------------------------
3cr7A           ------------------------
3dhwC           ------------------------
1draA           T-----------------------
2a30A           L-----------------------
3c8uA           A-----------------------
3cddF           ------------------------
2c7cH           V-----------------------
2b92B           LAQLEK------------------
3dyoA           ------------------------
2a2zB           LDVNED------------------
2bbsB           L-----------------------
2d4uB           ------------------------
1e9rE           L-----------------------
3dt7A           ------------------------
3dlbB           R-----------------------
1e2iB           ------------------------
1e4yA           R-----------------------
3dymA           V-----------------------
3d1mA           ------------------------
3cbnA           ------------------------
2b8tB           ------------------------
1drbA           T-----------------------
2bbtB           ------------------------
3cddD           AGLPTVGGIKADVTDSE-------
2dr3E           L-----------------------
3dfnD           H-----------------------
6aldA           H-----------------------
1bmfC           ------------------------
1dyhA           T-----------------------
3bb1B           W-----------------------
2bkiA           KK----------------------
1cjaA           ------------------------
3dfqC           H-----------------------
1e9rD           L-----------------------
2akaA           ------------------------
2bhvA           ------------------------
2d4hB           QVNGP-------------------
2bjbA           ------------------------
1dp0A           VDVEVASDTPHPARI---------
3d31A           ------------------------
2d3wD           ------------------------
4dfrA           T-----------------------
2e85B           ------------------------
2bkhA           I-----------------------
2awoC           ------------------------
3dm9B           ------------------------
1d6jB           ------------------------
1e6cA           ------------------------
2b8tC           VPNRPSNSEEFIKFFKN-------
2czvB           ------------------------
1eilA           G-----------------------
3bb1A           ------------------------
1bglA           ------------------------
2eg5G           EGHLEEEKLDSF------------
2d2eA           ------------------------
3dffA           ------------------------
2ck3C           ------------------------
3dfoC           H-----------------------
2b8wB           F-----------------------
1cr0A           LERNQ-------------------
1adoA           H-----------------------
2c4rL           ------------------------
2a1fF           ------------------------
1e2kA           ------------------------
1e9sM           ------------------------
3bb1F           ------------------------
3bv4A           H-----------------------
3clvA           ------------------------
3bb1E           LPNGI-------------------
3cr7B           ------------------------
2bwjA           ------------------------
2d3wA           L-----------------------
3bb1C           ------------------------
2ausC           MKE---------------------
3ch4B           ------------------------
1ak2A           YYSKR-------------------
3cnnA           ------------------------
3cmvB           ------------------------
2aunB           AI----------------------
3cnlA           ------------------------
3ecpA           ------------------------
1e2hB           ------------------------
1e59A           M-----------------------
3cmtD           ------------------------
3d3qA           LFNEVQHLVEQGFEASQSQAIGYK
3bk7A           F-----------------------
2cvfA           ------------------------
1ai4B           G-----------------------
2bhvD           DKSKIA------------------
2aumA           HRH---------------------
2dr3D           HGVD--------------------
1b0uA           ------------------------
2bv7A           ------------------------
1d8jA           ------------------------
1afrA           LMMRKKISMPAHLMY---------
3cddC           ------------------------
1e2kB           AKRERLDLAMLAAIR---------
3d1mB           ------------------------
2bx2L           R-----------------------
3bczC           LDKGSIIEQLDPVSFSNYLKKYH-
2d3wC           ------------------------
2aumB           PA----------------------
3be4A           VNAKLP------------------
2bofX           ------------------------
1e2nA           ------------------------
3cioD           ------------------------
3brwA           ------------------------
2bkeA           ------------------------
4atjA           ------------------------
3di4A           ------------------------
2a1fD           ------------------------
1d6jA           ------------------------
3dvlD           ------------------------
2ahwD           ------------------------
1e2gA           VDASK-------------------
2bbtA           L-----------------------
3dm5B           AATGA-------------------
2d7vA           ------------------------
2c5mD           EPQVCVIELGG-------------
2awnA           L-----------------------
2dftA           ------------------------
1dekB           ------------------------
3crmA           ------------------------
2aexA           GGGGISCVLQDGCVFEKA------
1dekA           ------------------------
2ccjA           VNADQ-------------------
3bwdD           ------------------------
3cueF           ------------------------
1e9sH           IRSWLEDPNGGNLFI---------
1e2iA           LQCGGSWREDWGQLSGTG------
2ahvA           -MMQVQKMVKKATLHPK-------
2d7vB           ------------------------
1e9rG           PNGGNLFITWREDMGPALRPL---
1cjtC           ------------------------
1e9rF           IRSWLEDPNGGN------------
2dr3F           II----------------------
1e9sA           I-----------------------
3ed8A           ------------------------
1av6A           IVR---------------------
1akeA           V-----------------------
2e85A           IFLGI-------------------
2a1fE           M-----------------------
2ancF           ------------------------
1ckvA           ------------------------
3b85B           ------------------------
3bb1H           ------------------------
3d3qB           ------------------------
2d2fA           ------------------------
2dpyB           ------------------------
1chdA           L-----------------------
3bm2B           ------------------------
1bccF           ------------------------
2awoD           ------------------------
2dftC           ------------------------
3bb1G           LPNGI-------------------
1cs4C           ------------------------
1e2jA           LQC---------------------
3a00B           ------------------------
1e2mB           CGGSWREDWGQLSGPQSN------
1accA           L-----------------------
2bhvC           ------------------------
1e4vA           V-----------------------
2a1fC           ------------------------
1culC           ------------------------
3cqcA           ------------------------
2dr3C           LDLDE-------------------
1e9sI           L-----------------------
3cmuA           ------------------------
1e2nB           LQCGGS------------------
1e9sL           ------------------------
1e9sE           ------------------------
3b9qA           ------------------------
1dvrA           FYKKTG------------------
2ancB           A-----------------------
2c9gA           ------------------------
2b8tD           V-----------------------
3a00A           ------------------------
2anbA           AERLR-------------------
2an9A           A-----------------------
3c7kC           FDVGGQRSERKKWIH---------
1e2mA           GER---------------------
1e2lB           L-----------------------
3bb1D           ------------------------
3ec1A           ------------------------
1e1qB           ------------------------
1c9kC           ------------------------
2cdnA           ------------------------
2c9oA           KYIDQ-------------------
2b0lC           IESRS-------------------
1e9rB           IRSWLEDPNGGNL-----------
2dpyA           LSRR--------------------
2ancD           A-----------------------
3dvlC           ------------------------
1e2lA           ------------------------
1eamA           L-----------------------
3e70C           ------------------------
3cmwC           ------------------------
1cjuC           CFNDVTAIIFVVAS----------
1ek0A           ------------------------
3dofB           ------------------------
1e2hA           LQC---------------------
3c85A           ------------------------
3cddA           RYRPL-------------------
3bjqB           IDFGYEGDPYSIVPSA--------
3dfdA           ------------------------
2ekbA           ------------------------
2ax4B           ------------------------