[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55904.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bhpA.bssp"
#ERROR : Can't open dsspfile "2bjaA.bssp"
#ERROR : Can't open dsspfile "3ek1B.bssp"
#ERROR : Can't open dsspfile "3ek1G.bssp"
#ERROR : Can't open dsspfile "3ek1A.bssp"
#ERROR : Can't open dsspfile "2d4eC.bssp"
#ERROR : Can't open dsspfile "2d4eA.bssp"
#ERROR : Can't open dsspfile "1bxsA.bssp"
#ERROR : Can't open dsspfile "1a4sA.bssp"
#ERROR : Can't open dsspfile "3ed6A.bssp"
#ERROR : Can't open dsspfile "1a4zA.bssp"
#ERROR : Can't open dsspfile "1bi9A.bssp"
#ERROR : Can't open dsspfile "1bi9C.bssp"
#ERROR : Can't open dsspfile "3b4wA.bssp"
#ERROR : Can't open dsspfile "1bi9B.bssp"
#ERROR : Can't open dsspfile "1bi9D.bssp"
#ERROR : Can't open dsspfile "1ad3A.bssp"
#ERROR : Can't open dsspfile "1co3B.bssp"
#ERROR : Can't open dsspfile "1co3A.bssp"
#ERROR : Can't open dsspfile "3efvC.bssp"
#ERROR : Can't open dsspfile "3efvA.bssp"
#ERROR : Can't open dsspfile "3cyvA.bssp"
#ERROR : Can't open dsspfile "3dorA.bssp"
#ERROR : Can't open dsspfile "1ddqC.bssp"
#ERROR : Can't open dsspfile "3cskA.bssp"
#ERROR : Can't open dsspfile "1e0tA.bssp"
#ERROR : Can't open dsspfile "3cgwA.bssp"
#ERROR : Can't open dsspfile "3dorB.bssp"
#ERROR : Can't open dsspfile "3e08A.bssp"
#ERROR : Can't open dsspfile "3c3dA.bssp"
#ERROR : Can't open dsspfile "3c3eA.bssp"
#ERROR : Can't open dsspfile "2c8eG.bssp"
#ERROR : Can't open dsspfile "2cbuA.bssp"
#ERROR : Can't open dsspfile "3e96A.bssp"
#ERROR : Can't open dsspfile "1at3A.bssp"
#ERROR : Can't open dsspfile "3cniA.bssp"
#ERROR : Can't open dsspfile "3bjzB.bssp"
#ERROR : Can't open dsspfile "3bjqH.bssp"
#ERROR : Can't open dsspfile "2cbuB.bssp"
#ERROR : Can't open dsspfile "3dpmA.bssp"
#ERROR : Can't open dsspfile "2cbvA.bssp"
#ERROR : Can't open dsspfile "3ecvD.bssp"
#ERROR : Can't open dsspfile "2al2B.bssp"

## Summary of PDB Search
:474
    e-103  29%  2bhpA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    e-101  29%  2bjaA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    3e-99  34%  3ek1B  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-98  34%  3ek1G  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-98  34%  3ek1A  [x.x.x] ALDEHYDE DEHYDROGENASE
    5e-97  32%  2d4eC  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    1e-96  32%  2d4eA  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    2e-94  32%  1bxsA  [c.82.1] ALDEHYDE DEHYDROGENASE
    7e-94  29%  1a4sA  [c.82.1] BETAINE ALDEHYDE DEHYDROGENASE
    2e-93  29%  3ed6A  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    5e-93  30%  1a4zA  [c.82.1] ALDEHYDE DEHYDROGENASE
    4e-92  32%  1bi9A  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    1e-91  32%  1bi9C  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    2e-89  31%  3b4wA  [x.x.x] ALDEHYDE DEHYDROGENASE[MASQUE : MEMB(X) 46 / COIL(x)
    4e-87  32%  1bi9B  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    7e-86  32%  1bi9D  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    3e-85  26%  1ad3A  [c.82.1] ALDEHYDE DEHYDROGENASE (CLASS 3)
    6e-85  19%  1co3B  [x.x.x] ALDEHYDE DEHYDROGENASE
    6e-82  19%  1co3A  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-75  29%  3efvC  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    7e-75  29%  3efvA  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    3e-52  11%  3cyvA  [x.x.x] UROPORPHYRINOGEN DECARBOXYLASE
    4e-50   8%  3dorA  [x.x.x] PROTEIN CT_858
    3e-48  11%  1ddqC  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    2e-47  11%  3cskA  [x.x.x] PROBABLE DIPEPTIDYL-PEPTIDASE 3
    6e-46   6%  1e0tA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    8e-45   8%  3cgwA  [x.x.x] LPPG:FO 2-PHOSPHO-L-LACTATE TRANSFERASE
    8e-44   8%  3dorB  [x.x.x] PROTEIN CT_858
    8e-43  10%  3e08A  [x.x.x] TRYPTOPHAN 2,3-DIOXYGENASE
    2e-40   8%  3c3dA  [x.x.x] 2-PHOSPHO-L-LACTATE TRANSFERASE
    3e-37   7%  3c3eA  [x.x.x] 2-PHOSPHO-L-LACTATE TRANSFERASE
    8e-35  18%  2c8eG  [x.x.x] MONO-ADP-RIBOSYLTRANSFERASE C3
    2e-26   9%  2cbuA  [x.x.x] BETA-GLUCOSIDASE A
    3e-26   9%  3e96A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-25  11%  1at3A  [b.57.1] HERPES SIMPLEX VIRUS TYPE II PROTEASE
    1e-24  11%  3cniA  [x.x.x] PUTATIVE ABC TYPE-2 TRANSPORTER
    1e-24   9%  3bjzB  [x.x.x] PHOSPHOHEPTOSE ISOMERASE
    4e-21   8%  3bjqH  [x.x.x] PHAGE-RELATED PROTEIN
    1e-18   7%  2cbuB  [x.x.x] BETA-GLUCOSIDASE A
    1e-18  11%  3dpmA  [x.x.x] PROTEIN CT_858
    3e-16  10%  2cbvA  [c.1.8 (1oimA)] BETA-GLUCOSIDASE A
    1e-15  17%  3ecvD  [x.x.x] SUPEROXIDE DISMUTASE [CU-ZN]
    5e-05  22%  2al2B  [x.x.x] ENOLASE 1
:474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTRYQNLVNGKWKSSEQEITIYSPINQEELGTVPAMTQTEXXXXXXXXXXXXXXXXXXXXIERAAYLHKT
2bhpA           GRHYPLYIGGEWVDTKERMVSLNPSAPSEVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRSRLLLKA
2bjaA           GRHYPLYIGGEWVDTKERMVSLNPSAPSEVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRSRLLLKA
3ek1B           LLKSQCLVNGRWIDAADGIKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKW
3ek1G           LLKSQCLVNGRWIDAADGIKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKW
3ek1A           LLKSQCLVNGRWIDAADGIKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKW
2d4eC           --PALHFIAGEFVESGETFPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRI
2d4eA           --PALHFIAGEFVESGETFPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRI
1bxsA           --YTKIFINNEWHVSGKKFPVFNPATEEKLCEVEEGDKEDVDKAVKAARQAFQIGSPWRTSERGRLLNKL
1a4sA           VTDDLNYWGGRRKDGATTEPVFEPATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRVMLEA
3ed6A           --SQRQYIDGEWVANKNTRDIINPYNQEVIFTVSEGTDAERAILAARRAFESGEWSQETAETRGKKVRAI
1a4zA           --YNQIFINNEWHVSKKTFPTVNPSTGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMERGRLLNRL
1bi9A           IKYTKIFINNEWQNSERVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRSERGRLLDKL
1bi9C           IKYTKIFINNEWQESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRSERGRLLDKL
3b4wA           TEYDKLFIGGKWTSTSDVIEVRCPATGEYVXXXXXXXXXXXXXXXXXXXXXXXNGPWPSTHERAAVIAAA
1bi9B           IKYTKIFINNEWQESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRSERGRLLDKL
1bi9D           IKYTKIFINNEWQNSERVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRSERGRLLDKL
1ad3A           -------------------------------------------------------------FRIQQLEAL
1co3B           ------------------FYATNAFTGEALPLFPVHTEVEVNQAATAAAKVARDFRRLNNSKRASLLRTI
1co3A           --------------TDNVFYATNAFTGEALPLAPVHTEVEVNQAATAAAKVARDFRRLNNSKRASLLRTI
3efvC           -----------------QALSVNPATGQTLA-APWANAQEIEHALSLAASGFKKWKTSVAQ-RAQTLRDI
3efvA           --------------TATQALSVNPATGQTLAAPWA--NAQEIEHALSLAASGFKKWKTSVAQRAQTLRDI
3cyvA           ----------------------------------------------------------------------
3dorA           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
3cskA           ----------------------------------------------------------------------
1e0tA           -------------------------------------------------------------NKVICKVLN
3cgwA           -TGTPKLLDGLKEPEEELTVVVNTAEDLWSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGLGIEEGL
3dorB           ----------------------------------------------------------------------
3e08A           --------------------LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLIQSQTS
3c3dA           ----PKLLDGLKEPEEELTVVVNTAEDLWSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGLGIEEGL
3c3eA           ----PKLLDGLKEPEEELTVVVNTADLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTKELGIEEGL
2c8eG           ----------------------------------------------------------------------
2cbuA           GSPLADGAGMSITFSHTPGNVKNGDTGDVACDHYNRWKEDIEIIEKLGVKAYRFSISWPRIGTGRVNQKG
3e96A           ----------------------------------------------------------------------
1at3A           ----------------------------------------------------------------------
3cniA           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3bjqH           --KILTFGKEAFRNTKRTKRIDFGYEGDPYSIVPSALEAKVPRELRDASQVPGIDLGARSVTVLRIALAH
2cbuB           GSPLADGAGMSIWHTFSHTPGKNGDTGDVACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGT-GRV
3dpmA           ----------------------------------------------------------------------
2cbvA           GSPLADGAGMSITFSHTPGNVKNGDTGDVACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGR--
3ecvD           ----------------------------------------------------------------------
2al2B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AAILERDKEKIGTILAKEVAKGIKAAIGEVVRTADLIRYAAEEGXRITGQAMEGGGFEAASKNKLAVVRR
2bhpA           AALMRRRKRELEATLVYEVGKNWVEASADVAEAIDFIEYYARAALRYRYPAVEV----VPYPGEDNESFY
2bjaA           AALMRRRKRELEATLVYEVGKNWVEASADVAEAIDFIEYYARAALRYRYPAVEV----VPYPGEDNESFY
3ek1B           FDLIIANADDIALIMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIPA-----PQNGQRLTVIR
3ek1G           FDLIIANADDIALIMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIPA-----PQNGQRLTVIR
3ek1A           FDLIIANADDIALIMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIP-----APQNGQRLTVIR
2d4eC           AELIEKHADELAVMECLDAGQVLRIVRAQVARAAENFAFYAEYAEH----AMEDR-TFPVDRDWLYYTVR
2d4eA           AELIEKHADELAVMECLDAGQVLRIVRAQVARAAENFAFYAEYAEH----AMEDR-TFPVDRDWLYYTVR
1bxsA           ADLIERDRLLLATMEAMNGGKLFSAYLMDLGGCIKTLRYCAGWADKIQGRTIPMDG------NFFTYTRS
1a4sA           ARIIRERRDNIAKLEVINNGKTITEAEYDIDAAWQCIEYYAGLAPTLSGQHIQLPG------GAFAYTRR
3ed6A           ADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEM-----IDSPIPDTESKIVK
1a4zA           ADLIERDRTYLAALETLDNGKPYISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGD------YFSYTRH
1bi9A           ADLVERDRATLATMESLNGGKPFLAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDG------DYFTFTRH
1bi9C           ADLVERDRATLATMESLNGGKPFLAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDG------DYFTFTRH
3b4wA           VKMLAERKDLFTKLLAAETGQPPTIIETHWMGSMGAMNYFAGAADKVTWTETRTG------SYGQSIVSR
1bi9B           ADLVERDRATLATMESLNGGKPFLQAYIDLQGVIKTLRYYAGWADKIHGMTIPVDG------DYFTFTRH
1bi9D           ADLVERDRATLATMESLNGGKPFLAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGD------YFTFTRH
1ad3A           QRMINENLKSISGALASDLGKNEWSYYEEVAHVLEELDTTIKELPDWAEDEPVAKTRQT--QQDDLYIHS
1co3B           ASELEARSDDIIARAHLETALPEVRLTGEIARTANQLRLFADVVNSGSYHQAILDTPNPTRPKPDIRRQQ
1co3A           ASELEARSDDIIARAHLETALPEVRLTGEIARTANQLRLFADVVNSGSYHQAILDTPNPTRAKPDIRRQQ
3efvC           GQALRAHAEEAQCI--TREGKPIKQARAEVTKSAALCDWYAEHGPALNPEPTL-------VENQQAVIEY
3efvA           GQALRAHAEEAQCI--TREGKPIKQARAEVTKSAALCDWYAEHGPALNPEPTL-------VENQQAVIEY
3cyvA           -------------------------------------------------------------------VDV
3dorA           ---------------------------------------------------------------HLLQVKY
1ddqC           ------------------------AQANTPLEGDRIATDRVVARRR-----GEPVIVAPEEVEFMDVSPK
3cskA           ----------------------------------------------------------------------
1e0tA           NGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVI-----EIREHLKAHGGE
3cgwA           KLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLIKANILPSDDPVSTYIETAEGI------HFQDFWIGK
3dorB           -------------------------------------------------------------------VKY
3e08A           ELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTP-----------SEYMGFR
3c3dA           KLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLIKANILPSDDPVSTYIETAEGIHFQDFW------IGK
3c3eA           KLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFKANILPSDDPVSTYIETAEGIHFQDFW------IGK
2c8eG           -------------------------------------------------------------QEFTNIDQA
2cbuA           LDFYNRIID-----TLLEKGITPFVTIYHWDLPFALQLKGGWANR------EIADWFAEYSRVLFENFGD
3e96A           -------------------------------HYKETVDRIVDNGIDPCGNTSEFYALSLEEAKEEVRRTV
1at3A           --------------------------------------------------------------------RA
3cniA           ----------------------------------------------------------------------
3bjzB           ---------------------------------------------------------------RIRQLFQ
3bjqH           EHECAQIALDPAKYNADHKVKPDSDPTKDVETAKEAIADSIGEPNRLLSRCKYHPKLIEITIDLKALWEV
2cbuB           NQKGLDFYNRIIDTLLEKGITPFVTI-----YHWDLPFALQLKGGWANREIADWFA------EYSRVLFE
3dpmA           -------------------------------------------------------------------VKY
2cbvA           --VNQKGLDFYNRIIDTLLEKGITPVTIYHWDLPFALQLKGGWANREIADWFA---------EYSRVLFE
3ecvD           ----------------------------------------------------------------------
2al2B           -----------------------------------------------------------------HFFKT


                         +         .         .         .         .         *         .:210
query           EPVGIVLAIAPFNYPVNLSASKIAPALIAGNVVMFKPPTQGSISGLLLAKAFEEAGIPAGVFNTITGRGS
2bhpA           VPLGAGVVIAPWNFPVAIFTGMIVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGE
2bjaA           VPLGAGVVIAPWNFPVAIFTGMIVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGE
3ek1B           QPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAR
3ek1G           QPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAR
3ek1A           QPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAR
2d4eC           VPAGPVGIITPWNAPLMLSTWRIAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGE
2d4eA           VPAGPVGIITPWNAPLMLSTWRIAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGE
1bxsA           EPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPGYGP
1a4sA           EPLGVCAGILAWNYPFMIAAWKCAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQGGA-
3ed6A           EPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGS
1a4zA           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNVIPGFGP
1bi9A           EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
1bi9C           EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
3b4wA           EPVGVVGXXXXXXXXXXXXXXXXXXXXXXXCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPG-GI
1bi9B           EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
1bi9D           EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
1ad3A           EPLGVVLVIGAWNYPFNLTIQPMVGAVAAGNAVILKPSEVSGHMADLLATLIPQY-MDQNLYLVVKGGVP
1co3B           IALGPVAVFGASNFPLAFSAADTASALAAGCPVIVKGHTAHPGTSQIVAQALKQEQLPQAIFTLLQGNQR
1co3A           IALGPVAVFGASNFPLAFSAADTASALAAGCPVIVKGHTAHPGTSQIVAEALKQEQLPQAIFTLLQGNQR
3efvC           RPLG-VILAIPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQIARILAEA-GTPAGVYGWVNANNE
3efvA           RPLG-VILAIPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQIARILAEA-GTPAGVYGWVNANNE
3cyvA           TPVWMM-RQAGRYLPEYKATRAQAGDFMSLCKVTLQPLRRYPLDAAILFSILTVPDAMGLGLYFEAGEGP
3dorA           APKTWKEQYLGWDLV--------QSSVSAQQKLRTQENPSTSFCQQVLADFIGGLNDFAGVTFFAIESAY
1ddqC           QVFSLNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMIGLEERVVDSLAALYAEEDVKVDGTRI
3cskA           -----------------------------------------------------HFFADHDAPLSMLSVKT
1e0tA           NIHIISKIENQEGLNNFILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATMRPTDAE
3cgwA           RGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGRELLKKKKVVAV----SP
3dorB           APKTWKEQYLGWDLV--------QSSVSAQQKLRTQENPSTSFCQQVLADFIGGLDFHAGVTFFAIESAY
3e08A           DVLGPSSGFQSLQYR------YIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGH
3c3dA           RGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGRELLKKKKVV----AVSP
3c3eA           RGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNP-ITSIGPIISLPGRELLKKKKVVAVSP---
2c8eG           KAWGNA-QYKKYGLSKTKSASEINGKLRQNKGVI-FPSNLIKQVELL-DKSFNKMKTPENIMLFRGD---
2cbuA           RVKNWITLNEPWVVAIVGHLYGVHAPGMRDIYVAFRAVHNLLRAHARAVKVFRETVKDGKIGIVFNN---
3e96A           HGRALVVAGIGYATSTAIELGNAAKAAGADAVMIHMPIHPYVTAGGVYAYFIEALDFPSLVYFKDPEISD
1at3A           VPIYLALYDSGDPGELALDPDTVRAALPPENPLPINVDHRARCEVGRVLAVVNDPRLSREERLLYLITNY
3cniA           ----------------------------------------------------------------------
3bjzB           ASIETKQQALEVLPPYIEQASLVVNALLNEGKILSCGNGGSAGDAQHFSSELLNRFERERPSLPAVALTT
3bjqH           EEIVVGTARVATGNDSFGDVWGPDVWLGYVSDNP-DPSVEYQIEGHPLVEVPYWDNNAKSWIYGVSDDNT
2cbuB           NFGDRVKNWITLNEPWVVAIVGHLYGVHAPGMRDIYVAFRAVHNLLRRAVKVFRETVKDGKIGIVFNNGY
3dpmA           APKTWKEQYLGWDLVQSSVS--------AQQKLRTQENPSTSFCQQVLADFIGGLNFHAGVTFFAISAYL
2cbvA           NFGDRVKNWITLNEPWVVALYGVHAPGMRDIYVAFRAVHNLLRAHARAVKVFRETVKDGKIGIVFNNGYF
3ecvD           ----------------------------------------------------------------------
2al2B           AGIQIVADDLTVTNPKRIATAIEKKAA---DALLLKVNQIGTLSESIAAQDSFAAGWGVMVSH----RSG


                         .         .         .         +         .         .         .:280
query           EIGDYIIEHKEVNFINFTGSTPIGERIGRLAGMRPIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSG
2bhpA           EVGAYLVEHPRIRFINFTGSLEVGLKIYEAAGFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQG
2bjaA           EVGAYLVEHPRIRFINFTGSLEVGLKIYEAAGFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQG
3ek1B           EIGAELTSNDTVRKLSFTGSTEVGRLLMAQCAIKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAG
3ek1G           EIGAELTSNDTVRKLSFTGSTEVGRLLMAQCAIKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAG
3ek1A           EIGAELTSNDTVRKLSFTGSTEVGRLLMAQCAIKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAG
2d4eC           EAGAALVAHPLVPLLTLTGETETGKIVMRNAALKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNG
2d4eA           EAGAALVAHPLVPLLTLTGETETGKIVMRNAALKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNG
1bxsA           TAGAAISSHMDVDKVAFTGSTEVGKLIKEAAGKSNLKLELGGKSPCIVFADADLDNAVEFAHQGVFYHQG
1a4sA           ETGSLLCHHPNVAKVSFTGSVPTGKKVMEMSAVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQG
3ed6A           EVGDVMSGHKEVDLVSFTGGIETGKHIMKNAAVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAG
1a4zA           TAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSRVTLEIGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1bi9A           TAGAAIASHIGIDKIAFTGSTEVGKLIQEAANLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
1bi9C           TAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
3b4wA           ETGQALTSNPDIDMFTFTGSSAVGREVGRRAAEMPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAG
1bi9B           TAGAAIASHIGIDKIAFTGSTEVGKLIQEAANLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
1bi9D           TAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
1ad3A           ETTELL--KERFDHIMYTGSTAVGKIVMAAAALTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSG
1co3B           ALGQALVSHPEIKAVGFTGSVGGGRALFNLAHERPFYGELGAINPTFIFPSAMRAKADDQFVASMTMGCG
1co3A           ALGQALVSHPEIKAVGFTGSVGGGRALFNLAHERPFYGELGAINPTFIFPSAMRAKAADQFVASMTMGCG
3efvC           GVS--QINDPRIAAVTVTGSVRAGAAIGAQAGLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTG
3efvA           GVS--QINDPRIAAVTVTGSVRAGAAIGAQAGLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTG
3cyvA           RFTSPVTCKADVDKLPIPDPEDELGYVMN--AVRTIRHELKGEVPLIGFSGSPWTLATYMVEGGSSKAFT
3dorA           LPYTVQKSFYFVDIMTFSSEIRVGDELLEVDGAPDVLATLYGSNHKGTAAEESAALR----TLFSRMASL
1ddqC           AVRYEDGRLVEHPLRRYARSNQGTAFDQRPRGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNF
3cskA           EYFPQLTDKEQMSKASHAGSRVVMRQVSHESEPIAIHSKLNGKYP-----EDDITQKQQTGLYLEYVSQF
1e0tA           AGDVANAILDGTDAVMLSGEPLEAVSIMATICERRVMNSRLEITEAVCRGAVETAEKLDAPLIVVATQGG
3cgwA           IIGNAPVSGPAGKLPACGIEVSSGVAEYYQLDVFVFDERDRADEFAFERLGCHASRA-------DTLTST
3dorB           LPYTVQKRFYFVDIMTFSSEIRVGDELLEVDGAPDVLATLYGSNHKGTAAEESAALRTLFSRMASLGHKV
3e08A           AIPQQYQARDWAAHVADDTLRPVFERIYENTDRYWLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGG
3c3dA           IIGNAPVSGPAGKLPACGIEVSSGVAEYYQDFLDVFDERDRADEFAFERLGCHASRA-------DTLTST
3c3eA           IIGNAPVSGPAGKLPACGIEVSSGVAEYYQLDVFVFDERDRADEFAFERLGCHASRATLTSTEKSKELAE
2c8eG           ---DPAYLGTEFQNTLLNSNGTINKTAFEKAFLNKDRLEYGYISTSLMNVFAGRPIITKFKVAKGSKAGY
2cbuA           GYFEPASEKDIRAVRFMHQFNNYPLFLNPIYRYPELVLEFAREYLPENYKDDMSEIQEKIDFVGLNYYSG
3e96A           RVLVDLAPLQNLVGVKYAINDLPRFAKVVRSIPEEHQWICGTAEK---WAPFFWHAGAKGFTSGLVNLLP
1at3A           LPSVSLSTKPDRTLFAHVALCAIGRRLGTIVTLDAAIAPFRHLDPA------------------------
3cniA           --------------VAIVRED--TGTIAELAELGNVDIVYAGSDLAIIVIPKGFSQSLESGEKARLEIVW
3bjzB           DIRALGQPGDVLLAISTSGNSANVIQAIQADRELVVALTGRDGGGASLLLPEDVEI--------RVPSKI
3bjqH           PA--------------------------------------------------------------------
2cbuB           FEPASEKEEDIRAVRFMHQFNNYPLFLNPIYRGELVLEFAREYLPENYKDDMSEIQEKIDFVGLNYYSGH
3dpmA           PYTVQKSSFYFVDIMTFSSEIRVGDELLEVAPVQDVLATLYGSNHKGTAAEESAALRTLFSRMASLGHKV
2cbvA           EPASE--KEDIRAVRFMHQFNNYPLFLNPIYRGDELVLEFAREYLPENYKDDMSEIQEKIDFVGLNYYSG
3ecvD           ----------------------------------------------------------------------
2al2B           ETEDTFIADLVVTGQIKTGAPARSERLAKLNQLLRIEEELGDNA--------------------------


                         .         *         .         .         .         .         +:350
query           QRCTAIKRVIVLESVADKLATLLQEEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTP
2bhpA           QKCSAASRLILTQGAYEPVLERVLKRAERLSVGPAEENPDLGPVVSAEQERKVLSYIEIGKNEGQLVLGR
2bjaA           QKSAA-SRLILTQGAYEPVLERVLKRAERLSVGPAEENPDLGPVVSAEQERKVLSYIEIGKNEGQLVLGR
3ek1B           QTCVCANRIYVQRGVYDKFAEKLAAKVKELKVGNGTEGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITG
3ek1G           QTCVCANRIYVQRGVYDKFAEKLAAKVKELKVGNGTEGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITG
3ek1A           QTCVCANRIYVQRGVYDKFAEKLAAKVKELKVGNGTEGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITG
2d4eC           ERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDETEVGPLIHPEHLQRVLGYVEAGKREGARLLVG
2d4eA           ERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDETEVGPLIHPEHLQRVLGYVEAGKREGARLLVG
1bxsA           QCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLTGVSQGPQIDKEQYEKILDLIESGKKEGAKLECG
1a4sA           QVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVGDPLLETRMGGLISKPQLDKVLGFVAQAKKEGARVLCG
3ed6A           QVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDDTEMGPVISTEHRNKIESYMDVAKAEGATIAVD
1a4zA           QCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDRTEQGPQVDETQFKKVLGYIKSGKEEGLKLLCA
1bi9A           QCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG
1bi9C           QCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG
3b4wA           QGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPPSDAAQIGPLISEKQRTRVEGYIAKGIEEGARLVCG
1bi9B           QCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG
1bi9D           QCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG
1ad3A           QTCVAPDYILCDPSIQNQIVEKLKKSLKDFYGEDAKQSRDYGRIINDRHFQRVKGLIDNQKVAHGGTWDQ
1co3B           QFCTKPGVVFALNTPETQA-----FIETAQSLIRQQSSTLLTPGIRDSYQSQV---VSRGSDDGIDVTFS
1co3A           QFCTKPGVVFALNTPETQAFIET-----AQSLIRQQSSTLLTPGIRDSYQSQV---VSRGSDDGIDVTF-
3efvC           QVCAAAKRFIVEEGIAQAFTDRFVAAAAALKGDPLVEENDLGPARFDL-RDELHQQVQASVAEGARLLLK
3efvA           QVCAAAKRFIVEEGIAQAFTDRFVAAAAALKGDPLVEENDLGPARFDL-RDELHQQVQASVAEGARLLLK
3cyvA           VIKKMMYADPQALHALLDKLAKSVTLYLNAQIKAGAFDTWGGVLTGRDYQQFSLYYMHKIVDGLLRENDG
3dorA           GHKVPSGRTTLKIRRPFGTTREVRVKWRYVPEGVGDLATIAPIRAPQLGYNIGSTDGFLPVIGPVIWESE
1ddqC           EDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGIVR---IGAEVKP
3cskA           LSNLGNFKSFGDTKFIPRCEVKFFKQLLELAKINPSSPLTLSPVDVNHEFTSHHLFSTINELIDIGIYHG
1e0tA           KSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKTSTDDFYRLGKELALQSGLAHKGDVVVMVS
3cgwA           EKSKELAEIVV-----------------------------------------------------------
3dorB           PSGRTTLKIRRPFGTTREVRVKWRYVP------EGVGDLATIAPSIRAPQLGYNIGSTDGFLPVIGPVIW
3e08A           SSGVGFLQQALALTFFPE----LFDVRTSVGVDN------------------------------------
3c3dA           EKSKELAEIVVQAFLEH-----------------------------------------------------
3c3eA           IVVQAF----------------------------------------------------------------
2c8eG           IDP---------ISAFAGQLNMLLPRHSTYHIDDMRLSSDGKQIII------------------------
2cbuA           HLVKFDPDAKV-----------------------------------------------------------
3e96A           QKAVEMLEALRNNDNDAVWR-IWEDIVPFEDLRGKYNGNNVVVI---KEAMEMLRQNAGVTRAPVNELSN
1at3A           ----------------------------------------------------------------------
3cniA           YLRGTGLSEAVSTGTISSLIESLKVQLASFLLNDPKKQLLFDPLEIVQHTYLRGSLFKNHSPEAINVFY-
3bjzB           TARIQEVHLLAIHCLCDLIDRQLFG---------------------------------------------
3bjqH           ----------------------------------------------------------------------
2cbuB           LVK-------------------------------------------------------------------
3dpmA           PSGRT-----------------------------------------------------------------
2cbvA           HLVKFDPDAPAKVSFVE-----------------------------------------------------
3ecvD           ----------------------------------------------------------------------
2al2B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IKREGNLLWPVLFDQVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIA
2bhpA           LEGEGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWAR
2bjaA           LEGEGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWAR
3ek1B           GKELGLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVS
3ek1G           GKELGLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVS
3ek1A           GKELGLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVS
2d4eC           GERRGNYLLPTVFV-GENHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTRDLERAHRLA
2d4eA           GERRGNYLLPTVFV-GENHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTRDLERAHRLA
1bxsA           GGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVS
1a4sA           GEPNGYFMSPCVLDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRAHRVA
3ed6A           DLKDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVA
1a4zA           AADRGYFIQPTVFGDLQDGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLS
1bi9A           LGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVS
1bi9C           GKGKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVS
3b4wA           GGRNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVWTTDVPKGIKIS
1bi9B           LGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVS
1bi9D           LGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVS
1ad3A           SS---RYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKVIKKMI
1co3B           QAE-SPCVASALFVTSSENHPAWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEEDYPQIPR
1co3A           SQAESPCVASALFVTSSENWPAWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEEDYPQVSR
3efvC           IAGEGNYYAATVLADVTPDT-AFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEAA
3efvA           IAGEGNYYAATVLADVTPDT-AFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEAA
3cyvA           RRV-----PVTLFTKGGGQWLEAMAETGCDALGLDWTTDIADVALQGNMDPSMLYAPPARIEEEVATILA
3dorA           GLFRAYISSVTDGDGKSHKVGFLRIPTYSWQDMEDFDPSGPPPWEEFAKIIQVFSSNTEALIIDQTNNPG
1ddqC           GDILVGRTSFKGEQEPSPEERL-LRSIFGEKARDVKDTSLRVPP--------------------------
3cskA           FPSQGYTSAYYLGLPVTPDMALLKEQLFAELAILPENTRINKVG--ENSFQIWVASENVKNQ------IT
1e0tA           GALVP--------SGTTNTASVH-----------------------------------------------
3cgwA           ----------------------------------------------------------------------
3dorB           ESEGAYISSVTDGDGKSHKVGFLRIPTYSWQDMEDFDPSGPPPWEEFAKIIQ-----VFSSNTEALIIDQ
3e08A           ----------------------------------------------------------------------
3c3dA           ----------------------------------------------------------------------
3c3eA           ----------------------------------------------------------------------
2c8eG           ----------------------------------------------------------------------
2cbuA           ----------------------------------------------------------------------
3e96A           EDKQ------------------------------------------------------------------
1at3A           ----------------------------------------------------------------------
3cniA           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
2cbuB           ----------------------------------------------------------------------
3dpmA           ----------------------------------------------------------------------
2cbvA           ----------------------------------------------------------------------
3ecvD           ---------------VQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLR
2al2B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EKLEVGTVHINNKTQRGPDNFPFLGVKGSGAGVQGIKYSIEAMTNVKSIVFDxx
2bhpA           REFHVGNLYFNRKITGALVVQPFGGFKLSGTNAKGALDYLRLFLEMKAVA----
2bjaA           REFHVGNLYFNRKITGALVVQPFGGFKLSGTNATGALDYLRLFLEMKAVA----
3ek1B           EALEYGMVGHNTGL-ISNEVAPFGGVKQSGLGREGSKYGIEEYLETKYIC----
3ek1G           EALEYGMVGHNTGL-ISNEVAPFGGVKQSGLGREGSKYGIEEYLETKYIC----
3ek1A           EALEYGMVGHNTGL-ISNEVAPFGGVKQSGLGREGSKYGIEEYLETKYIC----
2d4eC           LELEAGMVYLNSHN-VRHLPTPFGGVKGSGDRREGGTYALDFYTDLKTIALP--
2d4eA           LELEAGMVYLNSHN-VRHLPTPFGGVKGSGDRREGGTYALDFYTDLKTIA----
1bxsA           SALQSGTVWVNCYS-VVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIK--
1a4sA           ANLEAGTCYINTYS-ISPVEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVE--
3ed6A           NKLKLGTVWI-NDFHPYFAQAPWGGYKQSGIGRELGKEGLEEYLVSKHIL----
1a4zA           QALQAGTVWV-NCYDVFGAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVT----
1bi9A           SAMQAGTVWINCYGEFGLREY---------------------------------
1bi9C           SAMQAGTVWINCYN-AGEFGLEYSEVKTVTVK----------------------
3b4wA           QQIRTGTYGIN--WYAFDPGSPFGGYKNSGIGRENGPEGVEHFTQQKSVL----
1bi9B           SAMQAGTVWINCYGEFGLREY---------------------------------
1bi9D           SAMQAGTVWIN------------------CYNALNGEFGLREYSEVKTVT----
1ad3A           AETSSGGVTANDVIVHITVTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVK--
1co3B           LEEIAGRLVFNGWPTEVYAMVHGGPYPASTHSASTSAEAIHRWLRPVAYQ----
1co3A           LEEIAGRLVFNGWPEVGYAMVHGGPYPASTHSASTSAEAIHRWLRPVAYQ----
3efvC           R-LECGGVFING-YSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKN--
3efvA           R-LECGGVFING-YSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKN--
3cyvA           GFGHGEGHVFNLGHGIHQD-VPPEHAGVFVEAVHRLS-----------------
3dorA           GSVLYLYALLSMLTDRPLELPKH-------------------------------
1ddqC           ------------------------------------------------------
3cskA           ETYPSGQITLS--NAVTKVEFIFGDHSREMRLVASYLKEAQKFAANDTQ-----
1e0tA           ------------------------------------------------------
3cgwA           ------------------------------------------------------
3dorB           TNNPGGSVLYLY------------------------------------------
3e08A           ------------------------------------------------------
3c3dA           ------------------------------------------------------
3c3eA           ------------------------------------------------------
2c8eG           ------------------------------------------------------
2cbuA           ------------------------------------------------------
3e96A           ------------------------------------------------------
1at3A           ------------------------------------------------------
3cniA           ------------------------------------------------------
3bjzB           ------------------------------------------------------
3bjqH           ------------------------------------------------------
2cbuB           ------------------------------------------------------
3dpmA           ------------------------------------------------------
2cbvA           ------------------------------------------------------
3ecvD           HVGDLGNVTADKDG---VADVSIEDSVISLSGDHCI------------------
2al2B           ------------------------------------------------------