[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55996.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1br2A.bssp"
#ERROR : Can't open dsspfile "2cevA.bssp"
#ERROR : Can't open dsspfile "1cevA.bssp"
#ERROR : Can't open dsspfile "2bhrA.bssp"
#ERROR : Can't open dsspfile "3eh1A.bssp"
#ERROR : Can't open dsspfile "2d7hA.bssp"
#ERROR : Can't open dsspfile "2ekdA.bssp"
#ERROR : Can't open dsspfile "2d7hB.bssp"
#ERROR : Can't open dsspfile "2d7hD.bssp"
#ERROR : Can't open dsspfile "2d7eA.bssp"
#ERROR : Can't open dsspfile "2d7eB.bssp"
#ERROR : Can't open dsspfile "2d7gA.bssp"
#ERROR : Can't open dsspfile "3e0jC.bssp"
#ERROR : Can't open dsspfile "2d7eD.bssp"
#ERROR : Can't open dsspfile "2d7gD.bssp"
#ERROR : Can't open dsspfile "2dxcH.bssp"
#ERROR : Can't open dsspfile "3egdB.bssp"
#ERROR : Can't open dsspfile "3dkpA.bssp"
#ERROR : Can't open dsspfile "3dinA.bssp"
#ERROR : Can't open dsspfile "3b6eA.bssp"
#ERROR : Can't open dsspfile "3bxuA.bssp"
#ERROR : Can't open dsspfile "1cu1A.bssp"
#ERROR : Can't open dsspfile "3dmqA.bssp"
#ERROR : Can't open dsspfile "2d7dA.bssp"
#ERROR : Can't open dsspfile "2aklA.bssp"
#ERROR : Can't open dsspfile "2cthA.bssp"
#ERROR : Can't open dsspfile "3caoA.bssp"
#ERROR : Can't open dsspfile "1d9xA.bssp"
#ERROR : Can't open dsspfile "3a43A.bssp"
#ERROR : Can't open dsspfile "2ekdF.bssp"
#ERROR : Can't open dsspfile "3a43B.bssp"
#ERROR : Can't open dsspfile "2dktA.bssp"
#ERROR : Can't open dsspfile "3berA.bssp"
#ERROR : Can't open dsspfile "1d9zA.bssp"
#ERROR : Can't open dsspfile "1a6yA.bssp"
#ERROR : Can't open dsspfile "1c4oA.bssp"
#ERROR : Can't open dsspfile "2dxcE.bssp"
#ERROR : Can't open dsspfile "3bxzB.bssp"
#ERROR : Can't open dsspfile "2db3A.bssp"
#ERROR : Can't open dsspfile "3crvA.bssp"
#ERROR : Can't open dsspfile "3dddA.bssp"
#ERROR : Can't open dsspfile "2ct7A.bssp"
#ERROR : Can't open dsspfile "3dwlD.bssp"
#ERROR : Can't open dsspfile "1a1vA.bssp"
#ERROR : Can't open dsspfile "2dgdA.bssp"
#ERROR : Can't open dsspfile "2bmfA.bssp"
#ERROR : Can't open dsspfile "3eaqB.bssp"
#ERROR : Can't open dsspfile "2bmfB.bssp"
#ERROR : Can't open dsspfile "2bwwA.bssp"
#ERROR : Can't open dsspfile "3cpeA.bssp"
#ERROR : Can't open dsspfile "3crw1.bssp"
#ERROR : Can't open dsspfile "3e1sA.bssp"
#ERROR : Can't open dsspfile "2ar5A.bssp"
#ERROR : Can't open dsspfile "2ekdA.bssp"

## Summary of PDB Search
:798
    4e-63  13%  1br2A  [b.34.3 - c.37.1] MYOSIN
    3e-37  13%  2cevA  [c.42.1] PROTEIN (ARGINASE)
    5e-37  14%  1cevA  [c.42.1] PROTEIN (ARGINASE)
    9e-37   8%  2bhrA  [x.x.x] RNA HELICASE
    8e-35  17%  3eh1A  [x.x.x] PROTEIN TRANSPORT PROTEIN SEC24B
    2e-25  35%  2d7hA  [x.x.x] PRIMOSOMAL PROTEIN N
    2e-25  12%  2ekdA  [x.x.x] HYPOTHETICAL PROTEIN PH0250
    5e-24  29%  2d7hB  [x.x.x] PRIMOSOMAL PROTEIN N
    2e-23  33%  2d7hD  [x.x.x] PRIMOSOMAL PROTEIN N
    7e-23  35%  2d7eA  [x.x.x] PRIMOSOMAL PROTEIN N'
    4e-22  35%  2d7eB  [x.x.x] PRIMOSOMAL PROTEIN N'
    4e-22  34%  2d7gA  [x.x.x] PRIMOSOMAL PROTEIN N
    6e-22  10%  3e0jC  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    1e-21  34%  2d7eD  [x.x.x] PRIMOSOMAL PROTEIN N'
    1e-21  35%  2d7gD  [x.x.x] PRIMOSOMAL PROTEIN N
    2e-16  11%  2dxcH  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT BETA
    1e-15  15%  3egdB  [x.x.x] PROTEIN TRANSPORT PROTEIN SEC24A
    1e-14  15%  3dkpA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX52
    5e-14  15%  3dinA  [x.x.x] PROTEIN TRANSLOCASE SUBUNIT SECA
    2e-12  22%  3b6eA  [x.x.x] INTERFERON-INDUCED HELICASE C DOMAIN-CONTAINING
    2e-12  15%  3bxuA  [x.x.x] CYTOCHROME C3
    4e-11  13%  1cu1A  [c.37.1 - c.37.1 - b.47.1] PROTEIN (PROTEASE/HELICASE NS3)
    2e-10  15%  3dmqA  [x.x.x] RNA POLYMERASE-ASSOCIATED PROTEIN RAPA
    3e-10  16%  2d7dA  [x.x.x] UVRABC SYSTEM PROTEIN B
    5e-10  12%  2aklA  [x.x.x] PHNA-LIKE PROTEIN PA0128
    6e-10  12%  2cthA  [a.138.1] CYTOCHROME C3
    1e-09  11%  3caoA  [a.138.1] CYTOCHROME C3
    1e-09  23%  1d9xA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    2e-09  21%  3a43A  [x.x.x] HYDROGENASE NICKEL INCORPORATION PROTEIN HYPA
    2e-09  15%  2ekdF  [x.x.x] HYPOTHETICAL PROTEIN PH0250
    2e-09  16%  3a43B  [x.x.x] HYDROGENASE NICKEL INCORPORATION PROTEIN HYPA
    5e-09  21%  2dktA  [x.x.x] RING FINGER AND CHY ZINC FINGER DOMAIN-
    7e-09  18%  3berA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX47
    7e-09  24%  1d9zA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    1e-08  17%  1a6yA  [g.39.1] ORPHAN NUCLEAR RECEPTOR NR1D1
    4e-08  21%  1c4oA  [c.37.1 - c.37.1] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB
    4e-08   9%  2dxcE  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT BETA
    2e-07  14%  3bxzB  [x.x.x] PREPROTEIN TRANSLOCASE SUBUNIT SECA
    2e-07  17%  2db3A  [x.x.x] ATP-DEPENDENT RNA HELICASE VASA
    6e-07  10%  3crvA  [x.x.x] XPD/RAD3 RELATED DNA HELICASE
    1e-06   9%  3dddA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    2e-05  10%  2ct7A  [x.x.x] RING FINGER PROTEIN 31
    3e-05   5%  3dwlD  [x.x.x] ACTIN-RELATED PROTEIN 2/3 COMPLEX SUBUNIT 2
    3e-05   8%  1a1vA  [c.37.1 - c.37.1] PROTEIN (NS3 PROTEIN)
    5e-05   5%  2dgdA  [x.x.x] 223AA LONG HYPOTHETICAL ARYLMALONATE
    7e-05  13%  2bmfA  [x.x.x] RNA HELICASE
    8e-05  26%  3eaqB  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    8e-05  20%  2bmfB  [x.x.x] RNA HELICASE
    2e-04  21%  2bwwA  [x.x.x] AMINOPEPTIDASE P
    3e-04   6%  3cpeA  [x.x.x] DNA PACKAGING PROTEIN GP17
    3e-04  17%  3crw1  [x.x.x] XPD/RAD3 RELATED DNA HELICASE
    5e-04  12%  3e1sA  [x.x.x] EXODEOXYRIBONUCLEASE V, SUBUNIT RECD
    6e-04  18%  2ar5A  [x.x.x] PHOSPHOINOSITIDE 3-KINASE
    2e-05  11%  2ekdA  [x.x.x] HYPOTHETICAL PROTEIN PH0250(query 559->622)
:798

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MALAKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSDGEEMEQDLKD
1br2A           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3eh1A           ----------------------------------------------------------------------
2d7hA           ---AHVALPVPL---PRTFDYLLPEGMT--VKAGCRVRVPFGKQQERI-GIVVSVSDASELPLNE--LKA
2ekdA           ----------------------------------------------------------------------
2d7hB           MPVAHVALPVP----PRTFDYLLEGM---TVKAGCRVRVPFG--KQERIGIVVSVDSELP------LNEK
2d7hD           --VAHVALPVPL---PRTFDYLLPEGMT--VKAGCRVRVPFG--QQERIGIVVSVSDASELPLNE--LKA
2d7eA           MPVAHVALPVPL---PRTFDYLLPEGMT--VKAGCRVRVPFGKQQERI-GIVVSVSDASELPLNE--LKA
2d7eB           MPVAHVALPVPL---PRTFDYLLPEGMT--VKAGCRVRVPFGKQQERI-GIVVSVSDASELPLNE--LKA
2d7gA           --VAHVALPVPL---PRTFDYLLPEGMT--VKAGCRVRVPFGKQQERI-GIVVSVSDASELPLNE--LKA
3e0jC           ----------------------------------------------------------------------
2d7eD           --VAHVALPVPL---PRTFDYLLPEGMT--VKAGCRVRVPFGKQQERI-GIVVSVSDASELPLNE--LKA
2d7gD           --VAHVALPVPL---PRTFDYLLPEGMT--VKAGCRVRVPFGKQQERI-GIVVSVSDASELPLNE--LKA
2dxcH           ----------------------------------------------------------------------
3egdB           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
3bxuA           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2aklA           ----------------------------------------------------------------------
2cthA           ----------------------------------------------------------------------
3caoA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3a43A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
3a43B           ----------------------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2ct7A           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------
2ar5A           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IAEVLDFSPVLTPEQLWLAEELRKSVFSYKISILKAMLPGFLxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1br2A           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3eh1A           ----------------------------------------------------------------------
2d7hA           VVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL----------------------------
2ekdA           ----------------------------------------------------------------------
2d7hB           AVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL----------------------------
2d7hD           VVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL----------------------------
2d7eA           VVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL----------------------------
2d7eB           VVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL----------------------------
2d7gA           VVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL----------------------------
3e0jC           ----------------------------------------------------------------------
2d7eD           VVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL----------------------------
2d7gD           VVEVLD--PVFTHSVWRLLLWAADYYHHPIGDVLFHALPI------------------------------
2dxcH           ----------------------------------------------------------------------
3egdB           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
3bxuA           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2aklA           ----------------------------------------------------------------------
2cthA           ----------------------------------------------------------------------
3caoA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3a43A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
3a43B           ----------------------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2ct7A           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------
2ar5A           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1br2A           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3eh1A           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
2d7hB           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3egdB           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
3bxuA           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2aklA           ----------------------------------------------------------------------
2cthA           ----------------------------------------------------------------------
3caoA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3a43A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
3a43B           ----------------------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2ct7A           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------
2ar5A           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxYSREQVNFFVDQGAVTIVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSS
1br2A           ---------------------------------------------KKRHEMPPHIYAIADTAYRSMLQDR
2cevA           -----------------------------------------------------------KPISIMDLGQT
1cevA           ------------------------------------------------------------DLGQTRRGVD
2bhrA           ----------------------------------------------------------------------
3eh1A           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2ekdA           -------------------------------------------------SEKFFKLFRVGETVLVEYSGT
2d7hB           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
2dxcH           --------------------------------------ALHQQTHAPAPTEITHTLFRAYTRVPHDVGGE
3egdB           ----------------------------------------------------------------------
3dkpA           ---------------MKINFLRNKHKIHVLPDPIATFQQLDQNILDAGFQMPTPIQMQAIPVM--LHGRE
3dinA           ------------VNSFEDADEHLFEAFALVREAARRT------------LGMRPFDVQVMGGIALHEG--
3b6eA           -----------------------------------------ARASPEPELQLRPYQMEVAQPALE-----
3bxuA           ----------------------------------------------------------------------
1cu1A           -----------------------------------------VESMETTMRSPVFTDNSSPPAVPQSFQV-
3dmqA           --------------------------------------------------SLIPHQLNIAHDVGRRHAPR
2d7dA           -----------------------------------------DRFELVSKYQPQGDQPKAIEKLVKGIQE-
2aklA           ----------------------------------------------------------------------
2cthA           ----------------------------------------------------------------------
3caoA           ----------------------------------------------------------------------
1d9xA           --------------------------------------------QLVAPYEPQGDQPQAIAKLVDGLRRG
3a43A           ----------------------------------------------------------------------
2ekdF           --------------------------------------------------KFFKLFRVGETVLVEYSGTS
3a43B           ----------------------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           ------------------------------------TDVLCEACDQLGWTKPTKIQIEAIPLA-----LQ
1d9zA           --------------------------------------------QLVAPYEPQGDQPQAIAKLVDGLRRG
1a6yA           ----------------------------------------------------------------------
1c4oA           ------------------------------------------------GPSPKGDQPKAIAGLVEALRD-
2dxcE           -------------------------------------------THAPAPTEITHTLFRAYTRVPHDV-GG
3bxzB           ------------------------------------EAFAVVREASKRVFGMRHFDVQLLGGMVL--NER
2db3A           ----------------------------------------------------------------------
3crvA           -------------------------------------------------VKLRDWQEKLKDKVIEGLRNN
3dddA           ----------------------------------------------------------------------
2ct7A           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2dgdA           -------------------------------------------LKYSYSLLAEVSDIIIYGRTYGTHKHA
2bmfA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
2bmfB           -------------------------------------------------ASIEDNPEIEDDIF-----RK
2bwwA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3e1sA           -----------------------------------------EGIGFLTADKLWDDPRRLTAAAV------
2ar5A           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKY
1br2A           EDQILCTGESGAGKTENTKKVIQYLAKQLLQANPILEAFGNAKTVKNDNSSRFGKFINFDVTGYIVGANI
2cevA           RRDMGPSAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQR
1cevA           MGP---SAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQR
2bhrA           ----IMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPIRYQREIVDLMCHATF
3eh1A           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2ekdA           SRALLLYYIVNNSKLPIVVDDILDTYYTRLKVAGFDVAPLENVQVIKGGTKDIGRRLNISKYVISEQEYE
2d7hB           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
3e0jC           ---HGMFSEQAAQRAHTLLSPPSANNATFAR-VPVATYTNSSQPFRLIYATRLIQLENRAQQHWGSGVGV
2d7eD           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
2dxcH           ADVPIEYNTFATCECLAWRGVWTAEERRRKQNCDVGQTVYLGMPYYGRWLLTAARDKQFVTLTELHNKIV
3egdB           ----------------------------------------------------------------------
3dkpA           ---LLASAPTGSGKTLAFSMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAA
3dinA           ---KVAEMKTGEGKTLAATMPIYLNALIGKGVHLVTVNDYLARRDALWMGPVYGLRVGVINSLGKSYEVV
3b6eA           GKNIIICLPTGSGKTRVAVYIAKDHLDKKKKAIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSG----L
3bxuA           ----------------------------------------------------------------------
1cu1A           ---AHLHAPTGSGKSTKVPAAY---AAQGYKVLVLNPSVAATLGFGAYMSKAH-----------GIDPNI
3dmqA           ---VLLADEVGLGKTIEAGILHQQLLSGAAERVLIIVPETLQHQWLVEL-RRFNLRFALFDDERYAEAQH
2d7dA           ----GKKHQTLLGATGTGKTFTNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFAVEYFVSYYDYYQPEAY
2aklA           ----------------------------------------------------------------------
2cthA           ----------------------------------------------------------------------
3caoA           ----------------------------------------------------------------------
1d9xA           VKHQTLLGATGTGKTFTISNVIA---QVNKPTLVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYYDYYQP
3a43A           ----------------------------------------------------------------------
2ekdF           RAELLLYYIVNNSKLPIVVDDILDEFYTRLKVAGFDVAPLENVQVIKGGIGRVIGRLNISKYVISEQEYE
3a43B           ----------------------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           GRDIIGLAETGSGKTGAFALPILNALLERLFALVLTPTRELAFQISEQF-EALGSSIGVQSAVIVGGIDS
1d9zA           VKHQTLLGATGTGKTFTISNVIAQV---NKPTLVIAHNKTLAGQLYSELKEFFPHNAVEYF--VSYYDYY
1a6yA           ----------------------------------------------------------------------
1c4oA           ----GERFVTLLGATGTGVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPEEYFISYYDYYQPEAY
2dxcE           EADVPIENTFATCECLAWRGVWTAEERRRKQNCDVGQTVYLGMPYYGRWLLTAARDKQFVTLTELHNKIV
3bxzB           ---CIAEMRTGEGKTLTATLPAYLNALTGKGVHVVTVNDYLA-QRDAENNRPLFEFLGLTVGINLPGMPA
2db3A           ----------------------------------------------------------------------
3crvA           FL-VALNAPTGSGKTLFSLLVSL---EVKPKVLFVVRTHNEFYPIYRDLT-KIREKRNITFSFLVGKPSS
3dddA           ----------------------------------------------------------------------
2ct7A           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2dgdA           H----VIKRVIKDVVIPEESVYELLKKLNRKLWIGTPYIKERTLEEVEWWRNKGFEIVGYDG----LGKI
2bmfA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
2bmfB           KRLTIMDLHPGAGKTKRYLPIVREAIKRGLRTLILAPTRVVAAEMEEALRGLP-----------------
2bwwA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3crw1           ----ALNAPTGSGKTLFSLLVS---LEVKPKVLFVVRTHNEFYPIYRDLTKIREITFSFLVGKPS---SC
3e1sA           --YALQLAGTQAGHSFLPRSRAEKGVVHYTRVTPGQARLAVETAVELGRLSEDDSPLFAAATGEGRIYLP
2ar5A           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGS
1br2A           ETYLLEKSRAIRQAKDERTFHIFYYLIAGASLLEGFNNYTFLSNGHVPIPAQQDDEMFQETLEAMTIMGF
2cevA           GRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNHGMPLAASLGFGHPALTQIGG
1cevA           GRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNHGMPLAASLGFGHPALTQIGG
2bhrA           TMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVEMGEAAGIFMTATPPGSRDPFPQSNAPIMDE
3eh1A           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2ekdA           IVSQLKDYPVINPVLGLHKLILLGNENINVVKVSNYV--------------GREERIAFYFVNRNVIEKH
2d7hB           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
3e0jC           KKLCELQPEEKCCVVGTLFKAMSKHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLA----------VFG
2d7eD           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
2dxcH           EMRERVASG-------------------------------------------------------------
3egdB           ----------------------------------------------------------------------
3dkpA           KKFGPKSSKKFDILVTTPNRLIYLLASVEWLVVDESDKLFEDGGFRDQLASI---FLACTSHKVRRAMFS
3dinA           WKNPDLARKAIEENWSVWPDGFNGVLKEESMNKEAVEAFQVELKEITRKEAYLCDVTYGTNNDYLRDNLV
3b6eA           KISFPEVVKSCDIIISTAQILENQLSDFSLIIIDECVYNNIMRH--------------------------
3bxuA           ----------------------------------------------------------------------
1cu1A           RTGVRTITTGAPVTYSFLADGGCSGGAYDIIICDECHST-------------------------------
3dmqA           DAYNPFDTEQLVICSSKQRLEHLCEAEWDLLVVDEAHHLVWSEDAPSREY--------------------
2d7dA           VPQTDTFIEKDASINDRHSATSALFERRDVIIIASVSC-IYGLGSPEEYREMVVSLRTEM----------
2aklA           ----------------------------------------------------------------------
2cthA           ----------------------------------------------------------------------
3caoA           ----------------------------------------------------------------------
1d9xA           EYIEKDAKINDEIDKLRHSATSALFERRDVIIVA-SVSCIYGLGSPEEYRELVVSLRVGM----------
3a43A           ----------------------------------------------------------------------
2ekdF           IVSQLKDYPVINPVLGLHKLIGNTFENINVVKVSNYVG-----------REERIAFYFVNRNVIEK---H
3a43B           ----------------------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           MSQSLALAKKPHIIIATPGRLIDHLRALKYLVMDEADR-----ILNMDFETEVDKILKVIPRDRKTFLFS
1d9zA           QPEAYVPQTDTYIIDKLRHSATSALFERRDVIIVASVSCIYGLGSPEEYRELVVSL--------------
1a6yA           ----------------------------------------------------------------------
1c4oA           VPGKDLYIE-------------------------------------------------------------
2dxcE           EMRERVASGQGLGEY-------------------------------------------------------
3bxzB           PAKREAYAADITYGTN------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3crvA           CLYAEKGAESEDIPCKYCELKGSIVEVKTDDSPLSLVKKLKKDGLQDKFCPYYSLLNSLYKADVIALTYP
3dddA           ----------------------------------------------------------------------
2ct7A           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2dgdA           RGIDISNTPIFTIYRLVKRHLNEVIACTALSTYEAVQYLH-----EDLDPVVSENAAAWE--ALNKLKIK
2bmfA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3crw1           LESENSLYKADVIALTYPYFFIDRDLREYMIVIDEAHN--------------------------------
3e1sA           HVLRAEKKLASL----------------------------------------------------------
2ar5A           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVV
1br2A           TEEEQTSILRVVSSVLQLGNIVFKKEQ-ASMPDNTAAQKVCHLMGINVTDFTRSILTAKFERL--FRWIL
2cevA           YSPKIKPEHVVLIGVRSLDEGEKKF---IREKGIKIYTMHE-----VDRLGMTRVMEETIAYLKERTDGV
1cevA           YSPKIKPEHVVLIGVRSLDEGEKKF---IREKGIKIYTMHE-----VDRLGMTRVMEETIAYLKERTDGV
2bhrA           EREIPERSWNSGHEWVTDFK-GKTVWFVPSIKAGNDIAACLRKNGKKVIQLSRKTFDSEYIKTRTNDWDF
3eh1A           --------------------LTQERNILPMTPVWAPVPNADLKKLNCSPDSTQALLNKAKGLLLHPFRDL
2d7hA           ----------------------------------------------------------------------
2ekdA           SSPILDLLEEVVTSILE-----------------------------------------------------
2d7hB           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
3e0jC           SVRDDGKFLVEDYCFADLAPQK-PAPPLDTDRFVLLVSGLGLGGGGGESLLTQLLVDVVTGQL---GDEG
2d7eD           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3egdB           ----------------------------------------------------------------------
3dkpA           ATFAYDVEQWCKLN--------------------------------------------------------
3dinA           LDYN------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
3bxuA           -------------------------------------------------------------------DTM
1cu1A           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2aklA           ----------------------------------------------------------------------
2cthA           ----------------------------------------------------------------------
3caoA           ----------------------------------------DMTHVPTDAFGKLERPAAVFNHDEHNEKAG
1d9xA           ----------------------------------------------------------------------
3a43A           ----------------------------------------------------------------------
2ekdF           SSPILDLLEEVVTSILE-----------------------------------------------------
3a43B           ----------------------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           ATMTKKVQKLQRAA--------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
1c4oA           -----------------------------TVPQLQGMYRGDYARKKTLVDYGFRLPSALDNRPLRFEEFL
2dxcE           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3crvA           YFFIDRYREFIDIDLREYMIVIDEAHNLDKVNELEERSLSEITIQMAIKQSKSEESRRILSKLLNQLREV
3dddA           ----------------------------------------------------------------------
2ct7A           -----------------------------------------------------------------SGSSG
3dwlD           -----------------------------------------------------IDLQQLPADEEKEQLAM
1a1vA           ----------------------------------------------------------------------
2dgdA           AK--------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------
2ar5A           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQ
1br2A           TRVNKALDASFLGLDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGNFIDFGLDLQP
2cevA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
2bhrA           VVTTDISEMGANFKAERVIDPSAAQRRGRVGRNPKNENDQYIYMGEPLENDEDCAHWKEAKMLLDNINTP
3eh1A           TQLPVITSNTIVRCRSCRTYI-NPFVS-----FIDQRRWKCNLCYRVNDVPEKRPEVQNSTVEFIASSDY
2d7hA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
2d7hB           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
3e0jC           EQCSAAHVSRVILA--------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3egdB           --LPVVTSSTIVRCRSCRTYI-NPFVS-----FLDQRRWKCNLCYRVNDVPEEFLEPHRRPQNATIEFMA
3dkpA           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
3bxuA           TFTAKNGNTIVPDCAVCHGKTPGKIEGFGKEMAHGKSCKGCHEEM--KKGPTKCGECHKK----------
1cu1A           -IGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSK
3dmqA           QYQTAIKVSGIGARKSAEDRARDLYPERIYQEFEGDNATWWNFDPRVEWLGYLTSHRSQKVLVICAKAAT
2d7dA           ----------------------------------------------------------------------
2aklA           ----------------------CPQCNSEYTYEDGAL-LVCPECAHEWSPNEAATASDDGKVIKDSVGNV
2cthA           ----NHSTHKSVKCGDCYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGC-------HVEVAG
3caoA           IESCNACHHVEDSVGTPCSDCHALEQDGDTPGLQDAYHQQCWGCHEKAKGPVMCGECHVK----------
1d9xA           ------------------------------------------------------------------TLTK
3a43A           ----------------------CRNCNYEWKLKEVKDKFDERIKEDIHFIPEACPKCGSHDFEVVK-GRG
2ekdF           ----------------------------------------------------------------------
3a43B           ----------------------------------------CRNCNYEWKLKEACPKCGSHDFEVVKGRGV
2dktA           --------ACLLKAPCCDKLYTCRLCHDTNEDRFKVKEVQCINCEKLQHAQQTCEDCSTLFGEYY-----
3berA           ----------------------------------------------------------------------
1d9zA           ------------------------------------------------------------------TLTK
1a6yA           -----------LLCKVCGGVLACEGCKGFFRRSIQQNIQYNENCSIVRINRNRCQQCRFKKCLSVGMSRD
1c4oA           ERVSQVVFVSATPGPFELAHSGRVVEQIIR--PTGLLDPLVRVKPTENQILDLMEGIRERAARLVTVLTV
2dxcE           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2db3A           -----------RMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETK
3crvA           VLPDEKYIKVENVPKLSKEELEILADDYEDIRKDSLKQGKVNKIHIGSILRFFSLLS-------------
3dddA           ------------GYGLYKKFKFVDEYRTVRYELERPIKRVEGVVEVNKIPNWVKEIDKKAFGDDRIRVLE
2ct7A           ALFHKKLTEGVLMRDPKF--LWCAQCSFGFIYEREQLEATCPQCHEEQHRGRSCEDFQNW----------
3dwlD           SISMLKRNVLAAPFHRAFTKQAELAPMLDKQATSQELMAIHYRDEETIVLWPEHDRVTV----VFSTKFR
1a1vA           ------------TAGARLVVLATATPPGSVTVPHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCH
2dgdA           ----------------------------------------------------------------------
2bmfA           ------------IFMTATPPGSRDPFPQSNAPIMDEEREIPERSWNSGHEWVTDFKGKTVWFVPSIKAGN
3eaqB           ---------------------------------------------------------------MVFTRTK
2bmfB           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
3cpeA           ------------DIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHT
3crw1           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------
2ar5A           ----------------------------------------------------------------------
2ekdA           --------------------------------------------------------------------NV


                         .         .         .         *         .         .         .:630
query           KAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTA
1br2A           CIELIERPTNPPGVLALLDEECATDTSFVEKLIQEQGYAGKVTYNASAWLTKNMDPLNDNVTSLLNQSSD
2cevA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
2bhrA           EGIIPSMFEPEREKVDAIDGEYRLRGEARKTFVDLMRRGDLPVWLAYRVAAEGINYADRRWCFDGVKN--
3eh1A           MLRPP----QPAVYLFVLDVSHNAVEAGYLTILCQS----------LLENLDKLPGDSRTRIGFMTFDST
2d7hA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
2d7hB           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3egdB           PSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQS----------LLDNLDLLPGNTRTKIGFITFDST
3dkpA           ----------------------------------------------------------------------
3dinA           -----------------------------EAEIVAKAGQKGMVTIATNMAGRGTDIKLGPGVAELGGLCI
3b6eA           ----------------------------------------------------------------------
3bxuA           ----------------------------------------------------------------------
1cu1A           KKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCV--TQTVDFS
3dmqA           ALQLEQVLREREGIRAAVFHEGSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFASHV--------
2d7dA           ----------------------------------------------------------------------
2aklA           LQDGDTITVIK-----------------------------------------------------------
2cthA           ADAAKKKDLTGCK---------------------------------------------------------
3caoA           ----------------------------------------------------------------------
1d9xA           KMAEDLTDYLKEAGIKVAYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADK-
3a43A           VYVAGI----------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
3a43B           YVAGIKIEKEGGS---------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
1d9zA           KMAEDLTDYLKEAGIKVAYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADK-
1a6yA           A---------------------------------------------------------------------
1c4oA           RMAEELTSFLVEHGIRARYLHHELDAFKRQALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKE
2dxcE           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2db3A           RGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMP--
3crvA           ----------------------------------------------------------------------
3dddA           AYRRGARLLCAENEGFGLVYRGKIGP----LVADSPRVAEKILLKAFQLGAREIIIPEVNKDALELIK--
2ct7A           ----------------------------------------------------------------------
3dwlD           EETDRIFGKVFLQEFVDARRTAPQVL--FSYRDPPLEIRDIQFGVTFVLFERHFTPQNREDCISHIQV--
1a1vA           SKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVATDALFTGDFDSVIDCNTVTQT--------
2dgdA           ----------------------------------------------------------------------
2bmfA           DIAACLRKNGKKVIQLSRKT--------FDSEYIKTRTNDWDFVVTTDISEMGANFKAERVKPVILTDGE
3eaqB           AETEEIAQGLLRLGHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLP--
2bmfB           ----------------------------------------------------------------------
2bwwA           -----------------------------QALVEQMQPGSAALIFAAPEVTRSADSEYPYRQSDFWYFTG
3cpeA           AAFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVTDDVW
3crw1           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------
2ar5A           ----------------------------------------------------------------------
2ekdA           QVIKGGTKDIGRVIGRLNISKYVISEQEYEIVSQLKDYPVINPVLGLKLILLGNTFENINVV--------


                         .         +         .         .         .         .         *:700
query           LNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPP
1br2A           KFVADLWKRTVGQLYLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVL-EQLRCNGVLEGIRICRQGFPN
2cevA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
2bhrA           ----------NQILEENVEVEIWTKEGERKKLKPRWLDARIYSDP----LALKEFKEFAAGRK-------
3eh1A           IHFYNLQEGLSQPQMLIVSDIDDVFLPTPDSLLVNLYESKELPNMFTNTRETHSALGPALQAAFKLMSPT
2d7hA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
2d7hB           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3egdB           IHFYGLQESLSQPQMLIVSDIEDVFIPMPENLLVNLNE-SKELVQDLLKTLPQMFTKTLETQSALGPALQ
3dkpA           ----------------------------------------------------------------------
3dinA           IGTERHESRRIDNQLRGRA----GRQGDPGESIFFLSLEDDLLRIFGSEQIGKVMNILKIEEGQPIQHPM
3b6eA           ----------------------------------------------------------------------
3bxuA           ----------------------------------------------------------------------
1cu1A           LDPT------FTIETTTVPQDAVSRSQRRGR---------------------------------------
3dmqA           FDLP------FNPDLLEQRIGRLDRIGQAHDIQI------------------------------------
2d7dA           ----------------------------------------------------------------------
2aklA           ----------------------------------------------------------------------
2cthA           ----------------------------------------------------------------------
3caoA           ----------------------------------------------------------------------
1d9xA           ---EGFLRSERSL---IQTIGRAARNANGHVIMY------------------------------------
3a43A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
3a43B           ----------------------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
1d9zA           ---EGFLRSERSL---IQTIGRAARNANGHVIMY------------------------------------
1a6yA           ----------------------------------------------------------------------
1c4oA           GFLRSERS-------LIQTIGRAARNARGEVWLY------------------------------------
2dxcE           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2db3A           ----------SKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAI--------------------------
3crvA           ----------------------------------------------------------------------
3dddA           ----------IFKPSQVTSCRRLGSKIEEKVDIYYGILAY------------------------------
2ct7A           ----------------------------------------------------------------------
3dwlD           ------------FRNTLHFHIKASKAYMHQ----------------------------------------
1a1vA           -VDFSLDPTFTIE---TTTLPQDAVS--------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bmfA           ERVILAGPMPVTHSSAAQRRGRVGRNPKNE----------------------------------------
3eaqB           ----------DRAEAYQHRSGRTGRAGRGGRVVL------------------------------------
2bmfB           ----------------------------------------------------------------------
2bwwA           FNEPEA----------------------------------------------------------------
3cpeA           EQVGVLHSNTISHLILPDIVMRYLVEYNEC--------PVYIELNSTGVSVAKSLYMDLEYEGVIC----
3crw1           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------
2ar5A           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           YYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPILGPTPKPIARTHNLYHYQILIKYRLEDELGPT
1br2A           RIVFQ-----------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3eh1A           GGR-------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
2d7hB           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3egdB           AAF-------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3dinA           L---------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
3bxuA           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2aklA           ----------------------------------------------------------------------
2cthA           ----------------------------------------------------------------------
3caoA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3a43A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
3a43B           ----------------------------------------------------------------------
2dktA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2ct7A           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
3cpeA           --DSYTDLGMKQTKRTKAVGCSTLKDLIEKDLIIHHRATIQEFRTFS----EKGVSWAAEEGYHDDLVMS
3crw1           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------
2ar5A           YIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKI-ELNSY
2ekdA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LNQVLALTQERENSELxxxxxxxxxxxx
1br2A           ----------------------------
2cevA           ----------------------------
1cevA           ----------------------------
2bhrA           ----------------------------
3eh1A           ----------------------------
2d7hA           ----------------------------
2ekdA           ----------------------------
2d7hB           ----------------------------
2d7hD           ----------------------------
2d7eA           ----------------------------
2d7eB           ----------------------------
2d7gA           ----------------------------
3e0jC           ----------------------------
2d7eD           ----------------------------
2d7gD           ----------------------------
2dxcH           ----------------------------
3egdB           ----------------------------
3dkpA           ----------------------------
3dinA           ----------------------------
3b6eA           ----------------------------
3bxuA           ----------------------------
1cu1A           ----------------------------
3dmqA           ----------------------------
2d7dA           ----------------------------
2aklA           ----------------------------
2cthA           ----------------------------
3caoA           ----------------------------
1d9xA           ----------------------------
3a43A           ----------------------------
2ekdF           ----------------------------
3a43B           ----------------------------
2dktA           ----------------------------
3berA           ----------------------------
1d9zA           ----------------------------
1a6yA           ----------------------------
1c4oA           ----------------------------
2dxcE           ----------------------------
3bxzB           ----------------------------
2db3A           ----------------------------
3crvA           ----------------------------
3dddA           ----------------------------
2ct7A           ----------------------------
3dwlD           ----------------------------
1a1vA           ----------------------------
2dgdA           ----------------------------
2bmfA           ----------------------------
3eaqB           ----------------------------
2bmfB           ----------------------------
2bwwA           ----------------------------
3cpeA           LVIFGWLSTQ------------------
3crw1           ----------------------------
3e1sA           ----------------------------
2ar5A           LQSLMNASTDVAECDL------------
2ekdA           ----------------------------