[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55997.1

[Show Plain Result]

#ERROR : Can't open dsspfile "5croO.bssp"
#ERROR : Can't open dsspfile "5croA.bssp"
#ERROR : Can't open dsspfile "2bnmA.bssp"
#ERROR : Can't open dsspfile "1d1lA.bssp"
#ERROR : Can't open dsspfile "1copD.bssp"
#ERROR : Can't open dsspfile "2a63A.bssp"
#ERROR : Can't open dsspfile "2ecsA.bssp"
#ERROR : Can't open dsspfile "2bnoA.bssp"
#ERROR : Can't open dsspfile "2bnnB.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2ef8B.bssp"
#ERROR : Can't open dsspfile "3dnvB.bssp"
#ERROR : Can't open dsspfile "2ef8A.bssp"
#ERROR : Can't open dsspfile "3bdnA.bssp"
#ERROR : Can't open dsspfile "3d1nN.bssp"
#ERROR : Can't open dsspfile "3clcB.bssp"
#ERROR : Can't open dsspfile "2a6cA.bssp"
#ERROR : Can't open dsspfile "6croA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2ebyB.bssp"
#ERROR : Can't open dsspfile "3clcA.bssp"
#ERROR : Can't open dsspfile "3d1nP.bssp"
#ERROR : Can't open dsspfile "2b5aC.bssp"
#ERROR : Can't open dsspfile "2b5aA.bssp"
#ERROR : Can't open dsspfile "3croL.bssp"
#ERROR : Can't open dsspfile "2croA.bssp"
#ERROR : Can't open dsspfile "2ao9D.bssp"
#ERROR : Can't open dsspfile "2csfA.bssp"
#ERROR : Can't open dsspfile "2b5aB.bssp"
#ERROR : Can't open dsspfile "3croR.bssp"
#ERROR : Can't open dsspfile "1b0nA.bssp"
#ERROR : Can't open dsspfile "2ebyA.bssp"
#ERROR : Can't open dsspfile "2ao9G.bssp"
#ERROR : Can't open dsspfile "3bs3A.bssp"
#ERROR : Can't open dsspfile "2aw6A.bssp"
#ERROR : Can't open dsspfile "3b7hA.bssp"
#ERROR : Can't open dsspfile "3bd1A.bssp"
#ERROR : Can't open dsspfile "3bd1C.bssp"
#ERROR : Can't open dsspfile "2awiC.bssp"
#ERROR : Can't open dsspfile "2axuL.bssp"
#ERROR : Can't open dsspfile "2axvB.bssp"
#ERROR : Can't open dsspfile "2axuG.bssp"
#ERROR : Can't open dsspfile "3bd1B.bssp"
#ERROR : Can't open dsspfile "1adrA.bssp"
#ERROR : Can't open dsspfile "2ao9A.bssp"
#ERROR : Can't open dsspfile "2awiA.bssp"
#ERROR : Can't open dsspfile "2axuD.bssp"
#ERROR : Can't open dsspfile "2axuK.bssp"

## Summary of PDB Search
:53
    2e-08  29%  5croO  [a.35.1] CRO REPRESSOR PROTEIN
    2e-08  29%  5croA  [a.35.1] CRO REPRESSOR PROTEIN
    4e-08  21%  2bnmA  [x.x.x] EPOXIDASE
    1e-07  29%  1d1lA  [a.35.1] LAMBDA CRO REPRESSOR
    2e-07  29%  1copD  [a.35.1] CRO REPRESSOR
    2e-07  29%  2a63A  [x.x.x] REGULATORY PROTEIN CRO
    3e-07  24%  2ecsA  [x.x.x] PHAGE LAMBDA CRO
    4e-07  21%  2bnoA  [x.x.x] EPOXIDASE
    5e-07  21%  2bnnB  [x.x.x] EPOXIDASE
    1e-06  16%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    2e-06  34%  2ef8B  [x.x.x] PUTATIVE TRANSCRIPTION FACTOR
    2e-06  24%  3dnvB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR HIPB
    2e-06  34%  2ef8A  [x.x.x] PUTATIVE TRANSCRIPTION FACTOR
    5e-06  16%  3bdnA  [x.x.x] LAMBDA REPRESSOR
    5e-06  16%  3d1nN  [x.x.x] POU DOMAIN, CLASS 6, TRANSCRIPTION FACTOR 1
    6e-06  31%  3clcB  [x.x.x] REGULATORY PROTEIN
    7e-06  24%  2a6cA  [x.x.x] HELIX-TURN-HELIX MOTIF
    2e-05  31%  6croA  [a.35.1] LAMBDA CRO REPRESSOR
    2e-05  28%  2axzC  [x.x.x] PRGX
    2e-05  17%  2ebyB  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR YBAQ
    2e-05  31%  3clcA  [x.x.x] REGULATORY PROTEIN
    3e-05  28%  3d1nP  [x.x.x] POU DOMAIN, CLASS 6, TRANSCRIPTION FACTOR 1
    3e-05  25%  2b5aC  [x.x.x] C.BCLI
    3e-05  25%  2b5aA  [x.x.x] C.BCLI
    3e-05  29%  3croL  [a.35.1] PROTEIN (434 CRO)
    3e-05  29%  2croA  [x.x.x] REGULATORY PROTEIN CRO
    3e-05  17%  2ao9D  [x.x.x] PHAGE PROTEIN
    4e-05  12%  2csfA  [x.x.x] DNA-BINDING PROTEIN SATB2
    4e-05  25%  2b5aB  [x.x.x] C.BCLI
    5e-05  29%  3croR  [a.35.1] PROTEIN (434 CRO)
    7e-05  24%  1b0nA  [a.35.1 - a.34.1] PROTEIN (SINR PROTEIN)
    1e-04  17%  2ebyA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR YBAQ
    1e-04  20%  2ao9G  [x.x.x] PHAGE PROTEIN
    2e-04  19%  3bs3A  [x.x.x] PUTATIVE DNA-BINDING PROTEIN
    2e-04  24%  2aw6A  [x.x.x] PRGX
    2e-04  33%  3b7hA  [x.x.x] PROPHAGE LP1 PROTEIN 11
    3e-04  20%  3bd1A  [x.x.x] CRO PROTEIN
    3e-04  20%  3bd1C  [x.x.x] CRO PROTEIN
    3e-04  28%  2awiC  [x.x.x] PRGX
    4e-04  28%  2axuL  [x.x.x] PRGX
    4e-04  25%  2axvB  [x.x.x] PRGX
    4e-04  28%  2axuG  [x.x.x] PRGX
    4e-04  20%  3bd1B  [x.x.x] CRO PROTEIN
    5e-04  22%  1adrA  [x.x.x] P22 C2 REPRESSOR
    7e-04  17%  2ao9A  [x.x.x] PHAGE PROTEIN
    7e-04  28%  2awiA  [x.x.x] PRGX
    7e-04  28%  2axuD  [x.x.x] PRGX
    0.001  29%  2axuK  [x.x.x] PRGX
:53

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNMINVCDVGKRIKELRISSNLTQDKIAEYLSLNQSMIAKMEKGERNITNGxx
5croO           --------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIF----
5croA           --------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIF----
2bnmA           -------GFAELLKDRREQVKMDHAALASLLGETPETVAAWENGE--------
1d1lA           --------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIF----
1copD           --------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIF----
2a63A           --------MEQRITLKDYAMRFGQTKTAKDLGVQQSAINKWIHAGRKIF----
2ecsA           --------MEQRITLKDYAMRFGQTKTAKDLGVYPSSINQAIHAGRKIF----
2bnoA           -------GFAELLKDRREQVKMDHAALASLLGETPETVAAWENGE--------
2bnnB           -------GFAELLKDRREQVKMDHAALASLLGETPETVAAWENGE--------
1dw9A           INRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPAD--
2ef8B           -------RLVQLLTKLRKEASLSQSELAIFLGLSQSDISKIESFERRL-----
3dnvB           -------QLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTT----
2ef8A           -------RLVQLLTKLRKEASLSQSELAIFLGLSQSDISKIESFERRL-----
3bdnA           -------RLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGI--------
3d1nN           -------EFAKNFKIRRLSLGLTQTQVGQATATEGPAYSQSAISRFEKLD---
3clcB           -------KVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLT----
2a6cA           -------QLLIVLQEHLRNSGLTQFKAAELLGVTQPRVSDLRGKIDLFS----
6croA           ----------QRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIF----
2axzC           -------KIGSVLKQIRQELNYHQIDLYSGIS--KSVYIKVEADSRPIS----
2ebyB           --------GDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLT----
3clcA           -------KVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLT----
3d1nP           -------EFAKNFKIRRLSLGLTQTQVGQATAYSQSAISRFEKLDITPKS---
2b5aC           -EIEIKRKFGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNIS----
2b5aA           -EIEIKRKFGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNIS----
3croL           --------LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVT-------
2croA           --------LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVT-------
2ao9D           TAKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQ-------
2csfA           -NINITAAIYDEIQQEMKRAKVSQALFAKVAAKSQGWLCELLRWKENPS----
2b5aB           -EIEIKRKFGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNIS----
3croR           --------LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVT-------
1b0nA           --------IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQ-------
2ebyA           --------GDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLT----
2ao9G           --------YLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDF-----
3bs3A           -----------RIKVVLAEKQRTNRWLAE-QGKSENTISRWCSNKSQPS----
2aw6A           -------KIGSVLKQIRQELNYHQIDLYS-GIMSKSVYIKVEADSRPIS----
3b7hA           -------FVSEHLMELITQQNLTINRVATLAGLNQSTVNAMFEGRS-------
3bd1A           -----------AIDIAI-NKLGSVSALAASLGVRQSAISNWRARGRV------
3bd1C           -----------AIDIAI-NKLGSVSALAASLGVRQSAISNWRARGRV------
2awiC           --------IGSVLKQIRQELNYHQIDLYSGIS--KSVYIKVEADSRPIS----
2axuL           --------IGSVLKQIRQELNYHQIDLYSGIS--KSVYIKVEADSRPIS----
2axvB           --------IGSVLKQIRQELNYHQIDLYS-GIMSKSVYIKVEADSRPIS----
2axuG           --------IGSVLKQIRQELNYHQIDLYSGIS--KSVYIKVEADSRPIS----
3bd1B           -----------AIDIAI-NKLGSVSALAASLGVRQSAISNWRARGRV------
1adrA           MNTQLM---GERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPN----
2ao9A           -AKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQD------
2awiA           --------IGSVLKQIRQELNYHQIDLYSGIS--KSVYIKVEADSRPIS----
2axuD           --------IGSVLKQIRQELNYHQIDLYSGIS--KSVYIKVEADSRPIS----
2axuK           --------IGSVLKQIRQELNYHQIDLYSGIS--KSVYIKVEADSRPI-----