[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56069.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3edcA.bssp"
#ERROR : Can't open dsspfile "2an1B.bssp"
#ERROR : Can't open dsspfile "2bonB.bssp"
#ERROR : Can't open dsspfile "2an1A.bssp"
#ERROR : Can't open dsspfile "3egcD.bssp"
#ERROR : Can't open dsspfile "3bicB.bssp"
#ERROR : Can't open dsspfile "3egcA.bssp"
#ERROR : Can't open dsspfile "3ce9B.bssp"
#ERROR : Can't open dsspfile "1c7rA.bssp"
#ERROR : Can't open dsspfile "1b0zA.bssp"
#ERROR : Can't open dsspfile "3bicA.bssp"
#ERROR : Can't open dsspfile "3ce9A.bssp"
#ERROR : Can't open dsspfile "1dbqA.bssp"
#ERROR : Can't open dsspfile "2bonA.bssp"
#ERROR : Can't open dsspfile "3brqA.bssp"
#ERROR : Can't open dsspfile "1abeA.bssp"
#ERROR : Can't open dsspfile "3bilA.bssp"
#ERROR : Can't open dsspfile "1b2vA.bssp"
#ERROR : Can't open dsspfile "1bykA.bssp"
#ERROR : Can't open dsspfile "3cslC.bssp"
#ERROR : Can't open dsspfile "1efaC.bssp"
#ERROR : Can't open dsspfile "2dhhA.bssp"
#ERROR : Can't open dsspfile "3ddrC.bssp"
#ERROR : Can't open dsspfile "1dkhA.bssp"

## Summary of PDB Search
:335
    2e-25  17%  3edcA  [x.x.x] LACTOSE OPERON REPRESSOR
    2e-21  10%  2an1B  [x.x.x] PUTATIVE KINASE
    3e-18  11%  2bonB  [x.x.x] LIPID KINASE
    3e-17   9%  2an1A  [x.x.x] PUTATIVE KINASE
    1e-16  11%  3egcD  [x.x.x] PUTATIVE RIBOSE OPERON REPRESSOR
    3e-16  17%  3bicB  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    5e-16  11%  3egcA  [x.x.x] PUTATIVE RIBOSE OPERON REPRESSOR
    1e-15  11%  3ce9B  [x.x.x] GLYCEROL DEHYDROGENASE
    1e-15  14%  1c7rA  [c.80.1] PHOSPHOGLUCOSE ISOMERASE
    2e-15  12%  1b0zA  [c.80.1] PROTEIN (PHOSPHOGLUCOSE ISOMERASE)
    2e-13  18%  3bicA  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    4e-11   7%  3ce9A  [x.x.x] GLYCEROL DEHYDROGENASE
    2e-10  14%  1dbqA  [c.93.1] PURINE REPRESSOR
    5e-10  12%  2bonA  [x.x.x] LIPID KINASE
    2e-08  10%  3brqA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR ASCG
    7e-07   9%  1abeA  [x.x.x] L-ARABINOSE-BINDING PROTEIN
    8e-07  11%  3bilA  [x.x.x] PROBABLE LACI-FAMILY TRANSCRIPTIONAL REGULATOR
    9e-06  12%  1b2vA  [d.35.1] PROTEIN (HEME-BINDING PROTEIN A)
    9e-06  10%  1bykA  [c.93.1] PROTEIN (TREHALOSE OPERON REPRESSOR)
    1e-05  18%  3cslC  [x.x.x] HEMOPHORE HASA
    7e-05  14%  1efaC  [a.35.1 - c.93.1] LAC REPRESSOR
    9e-05  14%  2dhhA  [x.x.x] ACRB[MASQUE : MEMB(X) 253 / COIL(x) 0]
    2e-04  12%  3ddrC  [x.x.x] HEMOPHORE HASA
    2e-04  12%  1dkhA  [d.35.1] HEME-BINDING PROTEIN A
:335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
3edcA           -LLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKVHNLLAQRVSGLIINYPLDDQD
2an1B           ----------------------------------------------------THEMLYRWLCDQGYEVIV
2bonB           ---------------------------------SLLILNGKSTDNLP------LREAIMLLREEGM---T
2an1A           -------------------------------------------------HTTHEMLYRWLCDQGYEVIVE
3egcD           -NVVGLIVSDIENVFFAEVASGVESEARHKGYSVLLANTAEDIVREREAVGQFFERRVDGLILAPSEGEH
3bicB           -PRLLVAKMGQDGHDRGAKVIATG-------FADLGFDVDIGPLFQTPREVAQQAVDADVHAVGVSTLAA
3egcA           -NVVGLIVSDIENVFFAEVASGVESEARHKGYSVLLANTAEDIVREREAVGQFFERRVDGLILAPSEGEH
3ce9B           ----------------------------------------------------------------------
1c7rA           -------------------------------FDYSNALPFMQENELDYLSKAAHHMLHERKGPGSDFLGW
1b0zA           ---------------------------------ISFDYSNALPFMQENELDYLSEMLHERKGPGSDFLGW
3bicA           RPRLLVAKMGQDGHDRGAKVIATG-------FADLGFDVDIGPLFQTPREVAQQAVDADVHAVGVSTLAA
3ce9A           ----------------------------------------------------------------------
1dbqA           -KSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPE
2bonA           ---------------------------------SLLILNGKSTDNLPL------REAIMLLREEGM---T
3brqA           -QTLGLVVTNTLYHYFSELLFH-AARAEEKGRQLLLADGKHSAEEERQAIQYLLDLRCDAIIYPRFLSVD
1abeA           -LKLGFLVKQPEEPWFQTEWKFADKAGKDLGFEVIKIAVPDGEKTLNAIDSLAASGAKGFV------ICT
3bilA           ---IGVIVPSLINHYFAAMVTEIQSTASKAGLATIITNSNEDATTMSGSLEFLTSHGVDGIICVPNEECA
1b2vA           ----------------------------------------------------------------------
1bykA           -KVVAIIVTRLDSLSENLAVQTMLPAFYEQGYDPIMMESQFSPQLVAEHLGVLKRRNID-----GVVLFG
3cslC           -----------------------------------STANQVTAFVAGTLFQLDSLSFGDGLSGGDT----
1efaC           -LLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERVEACKTAVHNLLAQRVSGLIINYPLDDQD
2dhhA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
1dkhA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
3edcA           AIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWH
2an1B           EQQIAHELQLNVPTGTLAEIGQQADLAVVVGGDGNMLGAARLARYDINVIGINRGNLGFLT--------D
2bonB           IHVRVTWEKGDAARYVEEARKFGVATVIAGGGDGTINEVSTALIDIPALGILPLGTANDFATSGIPEALD
2an1A           QQIAHELQLKNVPTGTLAEIGQQADLAVVVGGDGNMLGAARTLRYDINVIGINRGNLGFLT--------D
3egcD           DYLRTELPKTFPIVAVRELRIPGCGAVLSENVRGARTAVEYLIARGHTRIGAIVGSAGLMTSRERLKGFR
3bicB           GHKTLVPEL------IKELNSLGRPDILVMCGGVPPQDYEFLFEVGVSNVFGPGTRIPKA----------
3egcA           DYLRTELPKTFPIVAVRELRIPGCGAVLSENVRGARTAVEYLIARGHTRIGAIVGSAGLMTSRERLKGFR
3ce9B           ---------FDEIGTNAFKIPAEVDALIGIGGGKAIDAVKYAFLRKLPFISVPTSTSND--------GFS
1c7rA           VDWPIRYNEFSRIKQAAERIRNHSDALVVIGIGGSYLGARAAIEHLLDVLEGKDLSINVISKSGTTTEPA
1b0zA           VDWPIRYDEFSRIKQAAERIRNHSDALVVIGIGGSYLGARAAIE----ALSHTFHNQMNDTTQIYFAGQN
3bicA           GHKTLVPELIKELNGRPDIL-------VMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPKA----------
3ce9A           ---------FDEIGTNAFKIPAEVDALIGIGGGKAIDAVKYAFLRKLPFISVPTSTSNDGFSSPVPAKTP
1dbqA           PLLAMLEEYRHIVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPA------GRLAGFM
2bonA           IHVRVTWEKGDAARYVEEARKFGVATVIAGGGDGTINEVSTALIDIPALGILPLGTANDFATSV---GIP
3brqA           EIDDIIDAHSQPIVLNRRLRKNSSHSVWCDHKQTSFNAVAELINAGHQEIAFLTGSDSP-TSIERLAGYK
1abeA           PDPKLGSAI------VAKARGY---DMKVIAVDDQFVNAKGKPMDTVPLVM----MAATKIGERQGQELY
3bilA           NQLEDLQKQMPVVLVDRELPGDTIPTATSNPQPGIAAAVELLAHNNALPIGYLSGPMDTSTGRERLEDFK
1b2vA           ----------------------------------VVHQVVYMSGDTGALETALNGILDDYG---LSVNST
1bykA           FTGITEEMLAQSSLVLLARDAKGFASVCYDDEGAIKILMQRLYDQGHRNISLGVPHSDVTTGKRRHEAYL
3cslC           ---SP----YSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGGALETALNGILDDYGLSNSTFDQV
1efaC           AIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWH
2dhhA           ----------------------------------------------------------------------
3ddrC           ----------------------------------VVHQVVYMSGDTGALETALNGILDDYG---LSVNST
1dkhA           ----------------------------------VVHQVVYMSGDTGALETALNGILDDYG---LSVNST


                         +         .         .         .         .         *         .:210
query           TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYE
3edcA           KYLTRNIQPIAEREGDWSAMSGFQQTMQMIVPTAMLVANDQMALGAM-RAITESGLRVGADISVVGYDDT
2an1B           LDPDNALQQLSDVLEGRYISEKRFLLEAQVCQQDRQKRISTAI--NEVVLHPGKVAHMIEFEVYIDETFA
2bonB           KALKLAIAGDAIAIDMAQVNKQTCFINMAT--GGFGTRIVSYIIHGLMRMDTLQPDRCE-----------
2an1A           LDPDNALQQLSDVLEGRYISKRFLLEAQVCQQRISTAINEVVLHPGKVAHMIEFEVYIDE-------TFA
3egcD           AAMSAAGLPVRQEWIAANGRDGAIVLTGADRPTALLTSSHRITEGAMQAL--------------------
3bicB           --AVQVLDDIEKCLEKKQQSVAE-----------------------------------------------
3egcA           AAMSAAGLPVRQEWIAANGRDGAIKVLTGDRPTALLTSSHRITEGAMQAL--------------------
3ce9B           SPVASLLINGKRTSVPAKTPDGIVVDIDVIKGSPEKFIYSGIGDLVSNITALYDWKFEEENHKSIIDDFA
1c7rA           IAFRIFRDYMEKKYGKEEARKRIYVT--TDRTKGALKKLADQEGYETFVIPDNIGGRYS-----------
1b0zA           ISSTYISHLLDVLEGIAFRIFRDYMEKKYGKEEARKRIYVTTDRGALKKLADQEGYETFVIPDNIGGRYS
3bicA           --AVQVLDDIEKCLE-------------------------------------------------------
3ce9A           DGIVVDIDVIKGSKFIYSGIGDLVSNITALYDWKFEEENHKSIIDDFAVISKKSVNSFVRTDFKSIKDEV
1dbqA           KAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIM---------------------
2bonA           EALDKAL---------------------------------------------------------------
3brqA           DALAQHGIALNEKLIANGKWTPASGAEGVELLERKFALVASNDDAIGAKALHERGVAVPEQVSVIGFDDI
1abeA           KEMQKRGWDVKESAVMAITANELDTARRRTTGSMDALKAAGF-PEKQIYQVPTKSNDIPGAFDAANSMLV
3bilA           AACANSKIGEQLVFLGGYEQSVGFEGATKLLDQGAKTLFAGDSMMTIGVICHKAGLVIGKDVSVIGFDTH
1b2vA           FDQVAAATA-------------------------------------------------------------
1bykA           AFCKAHKLHPVAALPGLAMKQGYENVAKV-----------------------------------------
3cslC           AAAT------------------------------------------------------------------
1efaC           KYLTRNIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLV-----------------------------
2dhhA           ----------------------------------------------------------------------
3ddrC           FDQVAAATA-------------------------------------------------------------
1dkhA           FDQVAAATA-------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           CGKKHNIIVLAEGVMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGI
3edcA           EDSSCYIPPLTTIKQDFRLLGQTSVDRNQLLPVSLVKRKTTLAPNTQTASPRALALMQLARQVSRLESG-
2an1B           FSQRSDGLIISTPTGSTAY-SLSAGGPILTPSLDAITLVPMFPH---TLSARPLVINSSSTIRLRFSHRR
2bonB           ----------------------------------------------------------------------
2an1A           FSQRSDGLIISTPTGSTAYSPHTLSARPLVINSSSTIRLRFSHDLEISCDSQIALPIQEGEDVLIRRCDY
3egcD           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
3egcA           ----------------------------------------------------------------------
3ce9B           V---ISKKSVNSFVRTDFKSIKDEVFLKELVDSLTNGIAEIAGNS----SPASGAEHLISHALDKFLPNP
1c7rA           ----------------------------------------------------------------------
1b0zA           VLTAVGLLPIAVAGLNIDRM--------------------------------------------------
3bicA           ----------------------------------------------------------------------
3ce9A           TNGIAEIAGNSSPASGAEHLISHALDKFLPNPQLHGIVATYISKVHKHREERIILSDTGF----------
1dbqA           ----------------------------------------------------------------------
2bonA           ----------------------------------------------------------------------
3brqA           AIAPYTVPALSSVKIPVTEIQEI-----------------------------------------------
1abeA           QHPEVKHWLVGMNDSTVLGGVRATEGQGINGVDAVSELSKAQATGFYGSLLPSPD-VHGYKSSEMLYNWV
3bilA           PLFALQPHPLTVIDQNVEQLAQR-----------------------------------------------
1b2vA           ----------------------------------------------------------------------
1bykA           ----------------------------------------------------------------------
3cslC           ----------------------------------------------------------------------
1efaC           ----------------------------------------------------------------------
2dhhA           ------------------QARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKDQEKAQALGNDINTTLGAAW
3ddrC           ----------------------------------------------------------------------
1dkhA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GGVAVGIRNEKMVENPILGTAEEGALFSLTAEGKIVVNNPHKADIELSSLxxxxx
3edcA           -------------------------------------------------------
2an1B           SDLEISCDSQIALPIQE--------------------------------------
2bonB           -------------------------------------------------------
2an1A           HLNLIHPKDYSYFN-----------------------------------------
3egcD           -------------------------------------------------------
3bicB           -------------------------------------------------------
3egcA           -------------------------------------------------------
3ce9B           QLHGIQV------------------------------------------------
1c7rA           -------------------------------------------------------
1b0zA           -------------------------------------------------------
3bicA           -------------------------------------------------------
3ce9A           -------------------------------------------------------
1dbqA           -------------------------------------------------------
2bonA           -------------------------------------------------------
3brqA           -------------------------------------------------------
1abeA           AKDVEPPKFTEVTD-----------------------------------------
3bilA           -------------------------------------------------------
1b2vA           -------------------------------------------------------
1bykA           -------------------------------------------------------
3cslC           -------------------------------------------------------
1efaC           -------------------------------------------------------
2dhhA           GGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAF-----
3ddrC           -------------------------------------------------------
1dkhA           -------------------------------------------------------