[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56087.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d5aX.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3a1tA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1egaA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2ahoA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2cxxA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3cwzA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3a1uB.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1an0A.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "1d5cA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"

## Summary of PDB Search
:292
    9e-23  22%  3d5aX  [x.x.x] PEPTIDE CHAIN RELEASE FACTOR 1
    2e-05  25%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-05  11%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-05  20%  4dcgA  [x.x.x] VP39
    6e-05  27%  3a1tA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-05  22%  3cmvA  [x.x.x] PROTEIN RECA
    7e-05  25%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    7e-05  26%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-04  22%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    2e-04  22%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-04  16%  1e2kA  [c.37.1] THYMIDINE KINASE
    2e-04  28%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    3e-04  61%  1egaA  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    3e-04  25%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    3e-04  24%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-04  27%  2ancF  [x.x.x] GUANYLATE KINASE
    3e-04  27%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    3e-04  21%  2ahoA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    3e-04  25%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    3e-04  25%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    4e-04  43%  2cxxA  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    4e-04  39%  3a00A  [x.x.x] GUANYLATE KINASE
    4e-04  14%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    5e-04  22%  3cmvH  [x.x.x] PROTEIN RECA
    5e-04  16%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    6e-04  39%  3cwzA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    6e-04  27%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-04  27%  3a1uB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    6e-04  24%  2cdnA  [x.x.x] ADENYLATE KINASE
    6e-04  29%  2cckA  [x.x.x] THYMIDYLATE KINASE
    7e-04  12%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    7e-04  32%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    7e-04  21%  1e2hA  [c.37.1] THYMIDINE KINASE
    7e-04  39%  1an0A  [c.37.1] CDC42HS-GDP
    8e-04  24%  2b8tC  [x.x.x] THYMIDINE KINASE
    8e-04  14%  1d5cA  [c.37.1] RAB6 GTPASE
    8e-04  29%  2cckB  [x.x.x] THYMIDYLATE KINASE
    8e-04  12%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    8e-04   7%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    8e-04  35%  1e98A  [c.37.1] THYMIDYLATE KINASE
    9e-04  29%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
:292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIHERKNSLVRPPI
3d5aX           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
3cnlA           -----------------------------------------------------------EKAKRQIKDLL
4dcgA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2ahoA           ---------------------------------------------------------GHEVLMATMLSGA
2c9yA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYRQTYGDIGYDFVTSK
3d5aX           ---------------LFARDLFNMYLRFAEEMGFETEVLDSHPTDLGGFSKVVFEVRGPGAYGTF----K
3czpB           ----------------------------------------------------------------------
3cnlA           RLVNTVVEVRDARAPFATSAYGVDFSRKETIILLNKVDIADEKTTKKWVEFFKKQGKRVITTHKEPRKVL
4dcgA           -------------------------------------------------------------LGELFFLSK
3a1tA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1av6A           -----------------------------------PFMYFEEIDN-ELDYEPESKLPYQGQLGELFFLSK
2c03B           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2ahoA           ALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQ-------------
2c9yA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3do6A           -----------------------------------------QLELKDDILYPYGHYIAKIDHR-FLKSLE
3cwzA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
2c61B           --------------------------------------------------ARLPPKDFIQT----GISTI
1e98A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGF
3d5aX           YESGVHRVQRVPVTETQGRIHTSTATVAVLDEIRIDVMRASGPGGQGVTTDSAVRVVHLPTGIMVTCQDS
3czpB           --------SLVAVFEGNDAAGKGGAIRRVTDALDPRQYHI------------------------------
3cnlA           LKKLSFDRLARVLIVGVPNTGKST----------------------------------------------
4dcgA           ---LQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVII------------------------------
3a1tA           ------------ALAGCPNVGKTSLFNALTG----TKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGT
3cmvA           ---GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTC------------------------------
2a2zD           --------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVP------------------------------
3crmA           --------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSA---------------------------
1av6A           ---LQRHGILDGATVVYIGSAPGTHIR-------------------------------------------
2c03B           ---PVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRP------------------------------
1e2kA           --------LLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPASETIANIYTTQHRLDQGEISAGDAAVVMT
2a30B           --------IKKISIEGNIAAGKSTFVNILKWEVVPEPVAR------------------------------
1egaA           ------------AIVGRPNVGKSTLLNKLL----------------------------------------
1bifA           --------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPT------------------------------
2dwoA           ---CGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPT------------------------------
2ancF           --------GTLYIVSAPSGAGKSSLIQALLKTQPLYDT--------------------------------
3czpA           ----------VAVFEGNDAAGKGGAIRRVTDALDPRQYHI------------------------------
2ahoA           ----------------------------------------------------------------------
2c9yA           --------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLAT------------------------------
2a2zB           --------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVP------------------------------
2cxxA           --------ATI-IFAGRSNVGKSTLIYRLT----------------------------------------
3a00A           ---------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFS------------------------------
1dekB           ---------KLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKD------------------------
3cmvH           ---GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTC------------------------------
3do6A           NHEDGKLILVTAVTPTPAGEGKTTTSIGLSSLNRIGKKSI------------------------------
3cwzA           ------------VFLGEQSVGKTSLITRFM----------------------------------------
3dmdC           ---RKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSV------------------------------
3a1uB           ------------ALAGCPNVGKTSLFNALT--------GTKQYVANTVEKKEGVFTYKGYTINLIDLPGT
2cdnA           --------HMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGE----------------------------
2cckA           ---------AFITFEGPEGSGKTTVINEVYHRLVKDYDVI------------------------------
3d31A           --------ALVRVKVDCGVPLNVLITRRSAEEMELSPGVQ------------------------------
1ek0A           ------------VLLGEAAVGKSSIVLRFVSNDFAENKEP------------------------------
1e2hA           --------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMT-----------------------------
1an0A           ------------VVVGDGAVGKTCLLISYT----------------------------------------
2b8tC           --------GWIEFITGPMFAGKTAELIRR-----------------------------------------
1d5cA           ------------VFLGEQAVGKTSIITRFYDTFDNNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQERF
2cckB           ---------AFITFEGPEGSGKTTVINEVYHRLVKDYDVI------------------------------
3d3kA           ---HGLTLERRLEMTGVCASQMALTLLGG-----------------------------------------
2c61B           DGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSES------------------------------
1e98A           --------GALIVLEGVDRAGKSTQSRKLVEALCAAGHR-------------------------------
2a5gA           ------------LMLGLDAAGKTTILYKLKLGQSVTTIPT------------------------------


                         .         .         .         +         .         .         .:280
query           SSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIxxxxxxxxxxxxxxxxxxx
3d5aX           RS--------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3a1tA           YSLGYS----------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e2kA           SAQITMGMPYAVTDAVLAP---------------------------------------------------
2a30B           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3a1uB           YSLGYS----------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1d5cA           RSLIPSYIRDSA---AAIVVYDITNRQSFENTTKWIQDILNERGKDVIIAL-------------------
2cckB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxx
3d5aX           ------------
3czpB           ------------
3cnlA           ------------
4dcgA           ------------
3a1tA           ------------
3cmvA           ------------
2a2zD           ------------
3crmA           ------------
1av6A           ------------
2c03B           ------------
1e2kA           ------------
2a30B           ------------
1egaA           ------------
1bifA           ------------
2dwoA           ------------
2ancF           ------------
3czpA           ------------
2ahoA           ------------
2c9yA           ------------
2a2zB           ------------
2cxxA           ------------
3a00A           ------------
1dekB           ------------
3cmvH           ------------
3do6A           ------------
3cwzA           ------------
3dmdC           ------------
3a1uB           ------------
2cdnA           ------------
2cckA           ------------
3d31A           ------------
1ek0A           ------------
1e2hA           ------------
1an0A           ------------
2b8tC           ------------
1d5cA           ------------
2cckB           ------------
3d3kA           ------------
2c61B           ------------
1e98A           ------------
2a5gA           ------------