[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56127.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cr3A.bssp"
#ERROR : Can't open dsspfile "2btdA.bssp"
#ERROR : Can't open dsspfile "3ct6B.bssp"
#ERROR : Can't open dsspfile "3cr3C.bssp"
#ERROR : Can't open dsspfile "3ct6A.bssp"
#ERROR : Can't open dsspfile "3b48D.bssp"
#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "2do8A.bssp"
#ERROR : Can't open dsspfile "3b48F.bssp"
#ERROR : Can't open dsspfile "3b48C.bssp"

## Summary of PDB Search
:555
    1e-31  17%  3cr3A  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE, ADP-
    3e-26  20%  2btdA  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE
    1e-15  13%  3ct6B  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    4e-14  12%  3cr3C  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    8e-14  13%  3ct6A  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    9e-11  13%  3b48D  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-10  11%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    9e-08  15%  2do8A  [x.x.x] UPF0301 PROTEIN HD_1794
    5e-06  10%  3b48F  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-05  11%  3b48C  [x.x.x] UNCHARACTERIZED PROTEIN
:555

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMGMTIENGAKEVADKPASTVGEVASIL
3cr3A           ---LTIDTTIEWLGKFNEKIQENKAYLSELDG-PIGDGDHGANARGSETKALEVSNFGNV-----SEIFK
2btdA           ---LSRTQIVNWLTRCGDIFSTESEYLTGLDRE-IGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNT
3ct6B           ----------------------------------------------------------------------
3cr3C           ----------------------------------------------------------------------
3ct6A           ----------------------------------------------------------------------
3b48D           ----------------------------------------------------------------------
2dt8A           ----------------------------------------------------------------------
2do8A           ----------------------------------------------------------------------
3b48F           ----------------------------------------------------------------------
3b48C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AKGLLMGARGNSGVITSQLFRGFSQAIKDKDELTGQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAI
3cr3A           KVATLSKVGGASGPLYGSAFLASKT------AIETLDTSELIYAGLEAIQKGKAQVGEKTVDIWSAFL--
2btdA           GMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADVISRGKAEPGDKTMCDVWVPVVE
3ct6B           ----------------------------------------------------------------------
3cr3C           ----------------------------------------------------------------------
3ct6A           ----------------------------------------------------------------------
3b48D           ----------------------------------------------------------------------
2dt8A           ----------------------------------------------------------------------
2do8A           ----------------------------------------------------------------------
3b48F           ----------------------------------------------------------------------
3b48C           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GAKKKAEQTDDTVEVMRAALEGAKTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALxxxxxxxxx
3cr3A           ----------NDLQTDSASKDNLEKVVKASAGLLATKRSIGHIDPGTQSSAYLFETLLEVV---------
2btdA           SLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARERSIGHQDPGATSVMFMMQMLALAA---------
3ct6B           ----------------------------------------------------------------------
3cr3C           ----------------------------------------------------------------------
3ct6A           ----------------------------------------------------------------------
3b48D           ----------------------------------------------------------------------
2dt8A           ----------------------------------------------------------------------
2do8A           ----------------------------------------------------------------------
3b48F           ----------------------------------------------------------------------
3b48C           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cr3A           ----------------------------------------------------------------------
2btdA           ----------------------------------------------------------------------
3ct6B           ----------------------------------------------------------------------
3cr3C           ----------------------------------------------------------------------
3ct6A           ----------------------------------------------------------------------
3b48D           ----------------------------------------------------------------------
2dt8A           ----------------------------------------------------------------------
2do8A           ----------------------------------------------------------------------
3b48F           ----------------------------------------------------------------------
3b48C           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEAQVEKEATQVIKSAEEKEYALIAVVAGKG
3cr3A           ----------------------------------------------------------------------
2btdA           ----------------------------------------------------------------------
3ct6B           ------------------------------------------------------------------IASG
3cr3C           -----------------------------------------------------------YGIVIVSHSPE
3ct6A           ------------------------------------------------------------------IASG
3b48D           ---------------------------------------------------------AKADILLVSHSKG
2dt8A           ----------------------------------------QDLRGRLGVRVVPLYVNLSGAIYRDWEEIT
2do8A           ----------------------------------------------------------------------
3b48F           ----------------------------------------------------------------------
3b48C           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNXFMAAQSAAEVLEQPAVVVEART
3cr3A           ----------------------------------------------------------------------
2btdA           ----------------------------------------------------------------------
3ct6B           LKKLIREVAKNISLTENGEIGTSFDRVMNAIEENEADNLLTFFDLGSARMNLDLVSEMTDKELTIFNVPL
3cr3C           IASVAKNISLTAIGGLENGEIGTSFDRVNAIEENEADNLLTFGSARNLDLVSETDKEL-----TIFNVPL
3ct6A           LKKLIREVAKNISLTENGEIGTSFDRVMNAIEENEADNLLTFFDLGSARMNLDLVSEMTDKELTIFNVPL
3b48D           IKEIEQNEEITIHSLGGTSDGSSDPKIIDTINEADDREFLIFADLGSAVLSSELAFDLEEDQQKHYDAPL
2dt8A           PTEIFQKVREGAAF--PTTSQPSPEDFARVYREALEEAVLSLHISGKLVQSAELAAQEFPGRVTVVDTQA
2do8A           ----------------------------------------------------------------------
3b48F           ----------------------SDPKIIDTINEADDREFLIFADLGSAVLSSELAFDLEEDQQKHYHLVD
3b48C           ----------------------SDPKIIDTINEADDREFLIFADLGSAVLSSELAFDLEEDQQKHYHLVD


                         .         .         +         .         .         .         .:490
query           LPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTTAVRDTTIDGLEIHENDNLGMVDGKILVSNPDM
3cr3A           ----------------------------------------------------------------------
2btdA           ----------------------------------------------------------------------
3ct6B           IEGAYTASALLEAGATFEAIKEQLEKMLIEKRSH------------------------------------
3cr3C           IEGAYTASALLEAGATFEAIKEQLEKLIE-----------------------------------------
3ct6A           IEGAYTASALLEAGATFEAIKEQLEKMLIEKRSHHHH---------------------------------
3b48D           VEGAFASAITAGVSDDLTQILAEAQNAGKK----------------------------------------
2dt8A           ASLGVGVLRAKELLEEGQSLEAVLAELERLRRDHFVRFSVATQAFLGTLLNLKPVLTLKEGRVEAAGKKA
2do8A           -------------------------------------------------------FGNLQGKFIIATPEM
3b48F           APLVEGAFASAGVSDDLTQILAEAQNAGKKGWN-------------------------------------
3b48C           APGAFASAITAGVSDDLTQILAEAQNAGKKGWN-------------------------------------


                         *         .         .         .         .         +         .:560
query           HQTLTETLKHMLDEDSEIVTFYVGEDGSEELANEIAQXXXXXXXXXXXXXHQGQQPVYPYLxxxx
3cr3A           -----------------------------------------------------------------
2btdA           -----------------------------------------------------------------
3ct6B           -----------------------------------------------------------------
3cr3C           -----------------------------------------------------------------
3ct6A           -----------------------------------------------------------------
3b48D           -----------------------------------------------------------------
2dt8A           REEILKAFRAWAEGRKRIRAYFLYSGDEDAVAALRQEVLASGLPVEEALVNELGAVIASHT----
2do8A           DDEYF--------DRTVIYICEHNDNGTLSVLELLTR---MDFQMAKPRIYTQDQMVL-------
3b48F           -----------------------------------------------------------------
3b48C           -----------------------------------------------------------------