[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56181.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1brmC.bssp"
#ERROR : Can't open dsspfile "1brmA.bssp"
#ERROR : Can't open dsspfile "1brmB.bssp"
#ERROR : Can't open dsspfile "1b7gO.bssp"
#ERROR : Can't open dsspfile "2b4rO.bssp"
#ERROR : Can't open dsspfile "1cf2P.bssp"
#ERROR : Can't open dsspfile "2cvoD.bssp"
#ERROR : Can't open dsspfile "3docD.bssp"
#ERROR : Can't open dsspfile "2b4tO.bssp"
#ERROR : Can't open dsspfile "1dbvO.bssp"
#ERROR : Can't open dsspfile "2duuA.bssp"
#ERROR : Can't open dsspfile "3docA.bssp"
#ERROR : Can't open dsspfile "3dr3A.bssp"
#ERROR : Can't open dsspfile "2cvoA.bssp"

## Summary of PDB Search
:358
    3e-30  19%  1brmC  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-27  19%  1brmA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    8e-27  19%  1brmB  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    4e-21   8%  1b7gO  [c.2.1 - d.81.1] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE
    1e-17  15%  2b4rO  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    2e-17  13%  1cf2P  [c.2.1 - d.81.1] PROTEIN (GLYCERALDEHYDE-3-PHOSPHATE
    3e-13  19%  2cvoD  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
    3e-13  16%  3docD  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    1e-12  18%  2b4tO  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    7e-11  18%  1dbvO  [c.2.1 - d.81.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    9e-11  18%  2duuA  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    5e-10  19%  3docA  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    6e-08  22%  3dr3A  [x.x.x] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    7e-05  19%  2cvoA  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
:358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
1brmC           ----------------VLMQRMVEERDFAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLELKALDIIVT
1brmA           -------------------------------------------------------------ALDIIVTCQ
1brmB           -----------------------------------------------------------------IVTCQ
1b7gO           -----------------ADAIIKQPDMKLVGVAKTSPNYEAFIAHRRGISGIPVAGTVEDLIKTSDIVVD
2b4rO           -----------------------------------------------------------------DVVCE
1cf2P           -----------------DMKVIGVSKTRPDFEARMALKKGYDLYVAIPKAGIEVAGTVDDMLDEADIVID
2cvoD           ----------------------------------------------------------------------
3docD           ---------------------------------------------------------------NVDIALE
2b4tO           ---------------------------------------------------------------QVDVVCE
1dbvO           ----------------------------------------------------------------VDIVVE
2duuA           -------------------------------------------------------------EWDIDLVIE
3docA           ------------------------------------------------------------------IALE
3dr3A           ----------------------------------------------------------------------
2cvoA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SAGSSTSAXYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
1brmC           CQGGDYTNEIYPKLREWQGYWIDAASSLRMKDDAIIILDPVNQDVLNNGIRTFVGGNCTVSLMLMSLGGL
1brmA           GGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVLNNGIRTFVGGNCTVSLMLMSLGGL
1brmB           GGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNTFVGGNCTVSLMLMSLGGL
1b7gO           TTPNGVGAQYKPIYLQLQRNAIFQGGEKAEVADISFSALCNYNE--ALGKKYIRVVSCNTTALLRTICTV
2b4rO           STGVFLTKELASSHLKGGAKKVIMSAPPK--DDTPIYVMGINHHQYDTKQLIVSNASCTTNCLAPLAKVI
1cf2P           CTPEGIGAKNLKMYKEKGIKAIFQGGEKHE--DIGLSFNSLSNYEESYGKDYTRCNTTGLCRTLKPLHDS
2cvoD           ----------------------------------------------------------------------
3docD           CTGIFTSRDKAALHLEAGAKRVIVSAPAD--GADLTVVYGVNNDKLTKDHLVISNASCTTNCLAPVAQVL
2b4tO           STGVFLTKELASSHLKGGAKKVIMSAPPK--DDTPIYVMGINHHQYDTKQLIVSNASCTTNCLAPLAKVI
1dbvO           STGRFTKREDAAKHLEAGAKKVIISAPAKNE--DITIVMGVNQDKYPKAHHVISNASCTTNCLAPFAKVL
2duuA           STGVFVTAEGASKHIQAGAKKV-LITAPGKAEGVGTYVIGVNDSEYHEDFAVISNASCTTNCLAPVAKVL
3docA           CTGIFTSRDKAALHLEAGAKRVIVSAPAD--GADLTVVYGVNNDKLTKDHLVISNASCTTNCLAPVAQVL
3dr3A           ----------------------------------------------------------------------
2cvoA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPRDLHAEILPSGGDKKHYPIAFNALPQID
1brmC           FANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELALDIERKVTTLTRSGELPVDNFGVPLA
1brmA           FANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHDELATPSSAILDIERKVTTTRSGELPVDNFGV
1brmB           FANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGELATPSSAILDIERKVTTLTRSGELPVDNFGVP
1b7gO           NKVSKVEKVRATIVRRAADQKEVKKGPINSLVPD----------------PATVPSHHAKDVNSVIRNLD
2b4rO           NDRFGIVEGLMTTVHASTANQL------------------------------VVDGPSKGGKDWRAGRCA
1cf2P           FGIKKVRAVIVRRGADPAQVSKGPINAIIPNPPKLPSH----------------------HGPDVKTVLD
2cvoD           ----------------------------------------------------------------------
3docD           NDTIGIEKGFMTTIHSYTGDQP-----------------------TLDTMHKDLYRARAAALSMIPTSTG
2b4tO           NDRFGIVEGLMTTVHASTANQLVVDGPSKG-----GKDWRAGRCALSNIIPSTGAAKAVGKVLPEL----
1dbvO           HEQFGIVRGMMTTVHSYTN------------------------DQRILDASHKDLRRARAAAESIIPTTT
2duuA           HDNFGIIKGTMTTTHSYARAAAVNIVPTTTGAAKAVAL-VIPE----------LKGKLNGIALRVPTPNV
3docA           NDTIGIEKGFMTTIHSYTGDQPTLD-TMHKDLYRARAAALSM------IPTSTGAAKAVGLVLPELK---
3dr3A           ----------------------------------------------------------------------
2cvoA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
1brmC           GSLIPWIDKEEWKGQAETNKILNTSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWV
1brmA           PLAGSLIPWIDWKGQAETNKILNTSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWA
1brmB           LAGSLIPWIDEWKGQAETNKILNTSSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWA
1b7gO           IATMAVIAPTTLMHMHFINITLKDKVEKKDILSVLENTPRIVLISSKYDAEATAELVEVARDLKRDRNDI
2b4rO           LSNIIPASTGAAKAVGKVLPEL---NGKLTGVAFRVPIGTVSVVDLVCRLQKPAKYEEVALEIKKAAEGP
1cf2P           --------------------------INIDTMAVIVPTTLMHQHNVMVEVEETPTVDDIIDVFEDTPRVI
2cvoD           ----------------------------ISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLSTYEGEE
3docD           AAKAVGLVLPEL-------------KGKLDGVAIRVPTPNVSVVDLTFIAKRETTVEEVNNAIREAANGR
2b4tO           -------------------------NGKLTGVAFRVPIGTVSVVDLVCRLQKPAKYEEVALEIKKAAEGP
1dbvO           GAAKA------------VALVLPELKGKLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALKA-----
2duuA           SVVDL-----------------------------------------------------------------
3docA           --------------------------GKLDGVAIRVPTPNVSVVDLTFIAKRETTVEEVNNAIREAANGR
3dr3A           --------------------------------PHLGNFPRGILETITCRLKSGVTQAQVAQALQQAYAHK
2cvoA           -------------------------------TPNLICMKRGMQSTMFVEMAPGVTANDLYQHLSTYEGEE


                         .         *         .         .         .         .         +:350
query           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
1brmC           PNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQL---------
1brmA           KVDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQL---------
1brmB           KVDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQL---------
1b7gO           PEVMIFSIYVKDDEVMLMYAVHQESIVVPENIDAIRASMMRITNESLGILKG------------------
2b4rO           LKGILGYTEDEV-VSQDFVHDNRSSIFDMKA----GLAL---NDNFFKLVSW------------------
1cf2P           LISAEDGLTST---AEIMEYAKELGRSRNDLFEIPVWRESITVVDNEIYYMQAVHQESDIVPENDAVRAI
2cvoD           FVKLLNGSSVPHTRHVVGSNYCFMNVFEDRIP--GRAIIISVIDNLVKGASGQAVQNLNLM---------
3docD           LKGYTDEKLVSHDFNHDSHSSVFHTD-----------QTKVMDGTMVRILSW------------------
2b4tO           LKGILGYTEDEVVSQDFVHDNRSS-----IFDM---KAGLALNDNFFKLVSW------------------
1dbvO           ----------------------------------------------------------------------
2duuA           ----------------------------------------------------------------------
3docA           LKGYTDEKLVSHDFNHDSHSSVF------HTDQ-----TKVMDGTMVRILSW------------------
3dr3A           PLVRLYDKGVPALKNVVGLPFCDIGFAVQG----EHLIIVATEDNLLKGAAAQAVQCAN-----------
2cvoA           FVKLLNGSSVPHTRHVVGSNYCFMNVFEDR--IPGRAIIISVIDNLVKGASGQAVQNLN-----------


                         .         .         .         .         *         .         .:420
query           AELxxxxx
1brmC           --------
1brmA           --------
1brmB           --------
1b7gO           --------
2b4rO           --------
1cf2P           LEM-----
2cvoD           --------
3docD           --------
2b4tO           --------
1dbvO           --------
2duuA           --------
3docA           --------
3dr3A           --------
2cvoA           --------