[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56217.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2bnlB.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "2bnlC.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "2bnlA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "3dsrB.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "1delB.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "2dwqB.bssp"

## Summary of PDB Search
:581
    1e-64  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    2e-54  39%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-41   9%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-40   9%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-38  13%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-38  10%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    6e-38  11%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-37  11%  3cmvH  [x.x.x] PROTEIN RECA
    2e-37  13%  2akaB  [x.x.x] DYNAMIN-1
    2e-37  19%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-37  11%  3cmvG  [x.x.x] PROTEIN RECA
    5e-37  15%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    5e-37   9%  2b8tA  [x.x.x] THYMIDINE KINASE
    1e-36  10%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-36  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-36  14%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    2e-35   9%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-35   8%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    7e-35  11%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    7e-35  17%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    1e-34  11%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-34  14%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    7e-34  10%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    1e-33  11%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    4e-33  10%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-33  13%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-33  10%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    8e-33  10%  1e98A  [c.37.1] THYMIDYLATE KINASE
    9e-33  14%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    9e-33  11%  3cmvC  [x.x.x] PROTEIN RECA
    1e-32  14%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    7e-32  13%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    8e-32   9%  3cmvA  [x.x.x] PROTEIN RECA
    1e-31  13%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    2e-31  13%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    6e-31  13%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    1e-30  10%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    1e-30   7%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    3e-30  10%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    4e-30  10%  4dcgA  [x.x.x] VP39
    5e-30  11%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    8e-30   7%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    2e-29   9%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-29   9%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    6e-29   6%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    7e-29  11%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    1e-28  10%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    3e-28  10%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    3e-28  10%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    5e-28   6%  2ctsA  [x.x.x] CITRATE SYNTHASE
    7e-28  10%  2bifA  [c.37.1 - c.60.1] PROTEIN
    7e-28  15%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-28  22%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-28  11%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    1e-27  11%  2c4rL  [x.x.x] RIBONUCLEASE E
    1e-27   8%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-27  10%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-25  11%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-25  10%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-25   8%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    2e-25  10%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    3e-25   8%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-25   9%  3da4A  [x.x.x] COLICIN-M
    5e-25   9%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    1e-24  11%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    2e-24   8%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    3e-24  11%  3ec1A  [x.x.x] YQEH GTPASE
    4e-24  10%  2cgtH  [x.x.x] 60 KDA GROEL
    4e-24  11%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    5e-24  14%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    9e-24   8%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    1e-23  11%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-23  10%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    2e-23  11%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    1e-22  10%  2cckA  [x.x.x] THYMIDYLATE KINASE
    1e-22  20%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-22   9%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-22   9%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    2e-22  11%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-22  13%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-22  14%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    3e-22  10%  1e0jA  [c.37.1] DNA HELICASE
    3e-22  12%  2c9oC  [x.x.x] RUVB-LIKE 1
    7e-22  10%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    8e-22   9%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    9e-22  12%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    1e-21   8%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    1e-21  12%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-21  11%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-21  12%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-21  14%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-21   6%  2axzC  [x.x.x] PRGX
    2e-21   7%  2b8tB  [x.x.x] THYMIDINE KINASE
    4e-21  14%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-21  13%  421pA  [x.x.x] H-RAS P21 PROTEIN
    6e-21   8%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    7e-21   9%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    8e-21  13%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    1e-20   9%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-20  10%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-20  12%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-20   6%  1aroP  [e.8.1] T7 RNA POLYMERASE
    2e-20  10%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-20   9%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    2e-20  10%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    2e-20  10%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-20  13%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    2e-20   9%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-20  13%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    4e-20  11%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    4e-20  10%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    4e-20  13%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-20   9%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-20  10%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    7e-20  11%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    1e-19  14%  3adkA  [x.x.x] ADENYLATE KINASE
    1e-19  16%  3c8uA  [x.x.x] FRUCTOKINASE
    1e-19  14%  2bdtA  [x.x.x] BH3686
    1e-19  13%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-19  22%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-19   7%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-19  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-19  12%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-19  13%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-19  22%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-19  25%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    4e-19   8%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    7e-19  11%  3cmxA  [x.x.x] PROTEIN RECA
    8e-19  10%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    8e-19  13%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    9e-19   7%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    1e-18   9%  3cmvE  [x.x.x] PROTEIN RECA
    1e-18  11%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    1e-18   8%  2b8tC  [x.x.x] THYMIDINE KINASE
    1e-18   8%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-18  14%  1e6cA  [c.37.1] SHIKIMATE KINASE
    2e-18   8%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    2e-18   6%  2bnlB  [x.x.x] MODULATOR PROTEIN RSBR
    3e-18  15%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    3e-18  10%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-18  10%  2bx2L  [x.x.x] RIBONUCLEASE E
    6e-18   9%  3bczC  [x.x.x] PROTEIN MEMO1
    6e-18  11%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    6e-18  11%  1e0jB  [c.37.1] DNA HELICASE
    8e-18  18%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-17  12%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-17  11%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    3e-17  12%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-17   9%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-17  10%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    3e-17  13%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-17  13%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    3e-17  17%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-17  12%  1e2kA  [c.37.1] THYMIDINE KINASE
    4e-17  12%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-17  10%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    6e-17  10%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    6e-17  14%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-17  10%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    7e-17  11%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-17   7%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    7e-17   8%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    8e-17  13%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-16   9%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    1e-16   7%  3bm2B  [x.x.x] PROTEIN YDJA
    1e-16  22%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-16  12%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-16  11%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    2e-16  15%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-16  11%  2bhvD  [x.x.x] COMB10
    4e-16   7%  2bnlC  [x.x.x] MODULATOR PROTEIN RSBR
    4e-16  12%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    4e-16  11%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    6e-16  10%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-16  15%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    8e-16  10%  2cckB  [x.x.x] THYMIDYLATE KINASE
    9e-16   8%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-15   9%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    1e-15  10%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-15   9%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    2e-15  14%  3cmtD  [x.x.x] PROTEIN RECA
    2e-15  15%  3a00A  [x.x.x] GUANYLATE KINASE
    2e-15  11%  2c0bL  [x.x.x] RIBONUCLEASE E
    3e-15   9%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    3e-15   9%  1e2iA  [c.37.1] THYMIDINE KINASE
    3e-15  10%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    3e-15  13%  3be4A  [x.x.x] ADENYLATE KINASE
    3e-15  11%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-15  10%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    4e-15  10%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-15  11%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    4e-15  15%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    4e-15   5%  2bnlA  [x.x.x] MODULATOR PROTEIN RSBR
    6e-15  15%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    6e-15  18%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-15   8%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    6e-15  20%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-15  10%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-15   9%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    7e-15  10%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-15  13%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-15   6%  2a1fF  [x.x.x] URIDYLATE KINASE
    1e-14  14%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    1e-14   7%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-14  11%  3cmvB  [x.x.x] PROTEIN RECA
    1e-14  11%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-14  11%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-14  16%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-14  10%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    2e-14   7%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    2e-14  11%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-14  11%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    2e-14  15%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    2e-14  12%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    2e-14  25%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    2e-14   8%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-14  10%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-14  12%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    3e-14  10%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-14   9%  2bhvA  [x.x.x] COMB10
    4e-14  12%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    5e-14   6%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-14  12%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    9e-14  10%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    9e-14  11%  1adoA  [c.1.10] ALDOLASE
    1e-13  12%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    1e-13  18%  2d2fA  [x.x.x] SUFC PROTEIN
    1e-13   5%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-13  12%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    2e-13  21%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    2e-13  11%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    2e-13  10%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    2e-13  10%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-13  10%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    3e-13  10%  3dlbB  [x.x.x] ARGONAUTE
    3e-13  17%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    3e-13   9%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-13   6%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    4e-13  10%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-13   9%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-13  14%  3a00B  [x.x.x] GUANYLATE KINASE
    5e-13  10%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-13  11%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    6e-13  19%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-13  12%  1e2iB  [c.37.1] THYMIDINE KINASE
    6e-13  11%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-13  12%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    8e-13  10%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-13  13%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    9e-13  10%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-12  12%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-12  10%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-12  11%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-12  10%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-12   9%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    2e-12  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    2e-12  13%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-12  11%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-12  16%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    2e-12  18%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-12   9%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-12   8%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    2e-12  11%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    2e-12  12%  1e2jA  [c.37.1] THYMIDINE KINASE
    2e-12  10%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-12  13%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-12  11%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    3e-12  19%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-12  21%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    3e-12  12%  1e2lA  [c.37.1] THYMIDINE KINASE
    3e-12  12%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    3e-12  12%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    5e-12   9%  3cmwC  [x.x.x] PROTEIN RECA
    5e-12  12%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    5e-12   9%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    6e-12  11%  1eamA  [c.66.1] PROTEIN (VP39)
    6e-12   9%  2b8tD  [x.x.x] THYMIDINE KINASE
    7e-12  13%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-12  10%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    9e-12  11%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    1e-11  15%  1e2mB  [c.37.1] THYMIDINE KINASE
    1e-11  14%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-11   7%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-11  15%  2anbA  [x.x.x] GUANYLATE KINASE
    2e-11  10%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    2e-11  10%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-11   6%  2a1fD  [x.x.x] URIDYLATE KINASE
    3e-11  15%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    4e-11  16%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    4e-11  13%  2ancF  [x.x.x] GUANYLATE KINASE
    4e-11  14%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    5e-11  10%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-11  12%  2dftA  [x.x.x] SHIKIMATE KINASE
    6e-11  23%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-11  12%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-11  16%  3cm0A  [x.x.x] ADENYLATE KINASE
    9e-11  19%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-11  10%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-10  12%  2cdnA  [x.x.x] ADENYLATE KINASE
    1e-10  18%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    1e-10  14%  1e2kB  [c.37.1] THYMIDINE KINASE
    1e-10   5%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-10  12%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-10  17%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-10  18%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-10  11%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-10  15%  2ancD  [x.x.x] GUANYLATE KINASE
    4e-10  12%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    6e-10  16%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    1e-09   6%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    1e-09   4%  2a1fC  [x.x.x] URIDYLATE KINASE
    2e-09  15%  2an9A  [x.x.x] GUANYLATE KINASE
    2e-09  11%  3cmuA  [x.x.x] PROTEIN RECA
    7e-09  13%  2dftC  [x.x.x] SHIKIMATE KINASE
    9e-09  12%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    1e-08   9%  2bhvC  [x.x.x] COMB10
    1e-08  15%  1e2nB  [c.37.1] THYMIDINE KINASE
    1e-08   9%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    2e-08  12%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-08  12%  1e2nA  [c.37.1] THYMIDINE KINASE
    3e-08  15%  2ancB  [x.x.x] GUANYLATE KINASE
    4e-08  12%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-08  11%  3dfdA  [x.x.x] PROTEIN YQBN
    1e-07  10%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    1e-07  12%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    1e-07  18%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-07  10%  1e2hA  [c.37.1] THYMIDINE KINASE
    2e-07  13%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    2e-07  10%  2c9gA  [x.x.x] PENTON PROTEIN
    3e-07   6%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    3e-07  10%  1e2jB  [c.37.1] THYMIDINE KINASE
    3e-07   6%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    3e-07  17%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    3e-07  12%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-07   7%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    4e-07  17%  1e2mA  [c.37.1] THYMIDINE KINASE
    4e-07   8%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    5e-07  11%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-07   9%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    6e-07  16%  2c95B  [x.x.x] ADENYLATE KINASE 1
    9e-07  11%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    9e-07  11%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    1e-06  11%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-06  19%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    1e-06  13%  3dkvA  [x.x.x] ADENYLATE KINASE
    2e-06  15%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    2e-06  13%  3dsrB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-06  10%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    7e-06  14%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    8e-06  16%  2c5mD  [x.x.x] CTP SYNTHASE
    8e-06  24%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    9e-06  12%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-05  33%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-05  24%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    1e-05  10%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    1e-05  18%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-05  12%  1e2lB  [c.37.1] THYMIDINE KINASE
    3e-05  18%  1chdA  [x.x.x] CHEB METHYLESTERASE
    4e-05  24%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    8e-05  10%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    8e-05  10%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    1e-04   7%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    1e-04  10%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-04  21%  2c9oB  [x.x.x] RUVB-LIKE 1
    2e-04  11%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-04  12%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    3e-04  13%  1delB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    4e-04  11%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-04  15%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    6e-04  14%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    8e-04  27%  2dwqB  [x.x.x] GTP-BINDING PROTEIN
:581

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIIQKLWWFFKLEKRRYLVGIVALILVSVLNLIPPMVMGRVIDAITSGXXXXXXXXXXXXXXXXAAFGM
3b60A           --TFRRLWPTIAPFKAGXXXXXXXXXXXXXXXXXXXXXXXPLLDDGFGKTXXXXXXXXXXXXXXXXXXXX
3b5jA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHATNDINALTRLAGGGVMSAVD
3b60A           XXX-YISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQV-ASXXXXXXXXXX
3b5jA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------SLDSLP----QEVRKFV-
2c03A           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3dt2A           --------------------------------------------------------------EGNAQLCQ
3eiuB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3dt4A           -----------------------------------------GLDFSAKVIQGSLDSLP-----QEVRKFV
3dmdB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3dt7A           -------------------------------------------GSMPPQLHNGLDFSAKVIQGS-LDSLP
3b2qB           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGRKTHKAFGESQAAFSELNNKVQESVSGIKVT
3b60A           XXXXXXXXXXXXXFYYSXXXXXXXXXXXXXXXXXXXXXXKRFRSISKNMQNTMGQVTTSAEQMLKGHKEV
3b5jA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3dtbB           EGNAQLCQPEYIHICDGAHMQEEGVIRKLKK-YDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKSG
2c03A           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3dt2A           PEYIHICDGSEEEYGRLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKSG
3eiuB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3dt4A           EGNAQLCQPEYIHICDGSEAHMQEEGVIRKLKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKSG
3dmdB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1accA           -------------PYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNETISKNTSTSRTHT
1e2dA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3dt7A           QEVRKFVEGNAQLCQPLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKSG
3b2qB           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3bgwA           -------------------------------------------------QAVLGSILTEP-ELIKECPLT
3dt4C           -------------------------------------------------------ITQEQRDTVPIPKSG
1e4yA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2bnlB           -------------------------------------------TVYQFIAENQNELLQLWTDTLKELSEQ
3bjdB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bnlC           ----------------------------------SNQ------TVYQFIAENQNELLQLWTDTLKELSEQ
3dm5B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2bnlA           -------------------------------------------TVYQFIAENQNELLQLWTDTLKELSEQ
3d1mB           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KSFGYQADELKSFQAVNELTFQKNLQTMKYDSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTF
3b60A           LIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISXXXXXXXXXXXXXXXXXXXXXXXVMDXXXXXXXXXX
3b5jA           ----------------------------------------------------------------------
3eiuA           --------------------------------------------EKTEPVGYNEIVNIKMGDGTVRRGQV
2c61B           -----------------------------------PLIFVE-KTEPVGYNEIVNIKMGDGTVRRGQVLDS
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3dtbB           QSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGTS
2c03A           ----------------------------------------------------------------------
1dkiA           -----------------------------------------------------DKVNLGGELSGSNMYVY
3dt2A           QSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRGDGEFIKC
3eiuB           -----------------------------------PLIFVE-KTEPVGYNEIVNIKMGDGTVRRG--QVL
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3b2qA           --------------------------------------LIFVEKTEPVGYNEIVNIKMGDGTVRRGQVLD
1e69A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3dt4A           QSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGTS
3dmdB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
3dm5A           -------------------------------------------------MVLDNLGKALANTLKKIARAS
3cmvA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1accA           SEVVSAGFSNSNSSTVAIDHSLSLAGGLNTADTARLNANIRY---VNTGTAPIYNVLPTTSLVLGKNQTL
1e2dA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3cddF           -------------------------------------------------------------LKAGGKIYQ
2c61A           --------------------------------------------EKTEPVGYNEIVNIKMGDGTVRRGQV
3dt7A           QSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVLEALGDGEFIKC
3b2qB           ----------------------------------GPLIFVEKPVGYNEIVNIKMGDGTVRRGQVL--DSS
2ahvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c4rL           ---------------------------------------------------------KKANIYKGKITRI
2czvA           ----------------------------------------------------------------------
3bgwA           PEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAARVGEKLPQLGGFGYLTELAASVASTTTFKQHCQTVSE
3dt4C           QSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVLEALGDGEFIKC
1e4yA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e1qB           -------------------------------SIGDGIARVGLRNVQAEEMVEFSSGLKGMSLNLEPDNVG
2b8wA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------NLPSYGNGAFSLSAPHVPGAGPLL
2axpA           ----------------------------------------------------------------------
2ck3C           -------------------------ETGRVLSIGDGIA-----RVHGLRNVQAEEMVEFSSGLKGMVVVF
2dr3E           ----------------------------------------------------------------------
3ec1A           -------------------------------------------------------MLHRI-GESKALVVN
2cgtH           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2bkhA           --------------------------------------------------------VFPAEEDSKKDVED
1e9sG           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3ed8A           --------------------------------------------------LTLKFICTTGKLPVPWPTLV
2d0kA           ----------------------------------------------------------------------
1bmfC           -------------------------------SIGDGIAVHGLRNVQAEMVEFSSGMSLNLEPDNVGVVVF
1e9sF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2bkiA           ----------------------------------SLTIEPLNQKGKTFLALINQVFPAEEDSKKD--VED
2a30A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2bnlB           ESYQLTDQVYENISKEYIDILLLSVKDENAAESQ-ISELALRAVQIGLSKFLATALAEFWKRLYTKNDES
3bjdB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bnlC           ESYQLTDQVYENISKEYIDILLLSVKDENLALRAVQIGLSKFLATALAEFWKRLYTKNDKRLPDQESTEL
3dm5B           -------------------------------------------------MVLDNLGKALANTLKKIARAS
1ek0A           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3b9qA           --------------------------------------------------VFSGFSKTRENLAVIDELLL
3cmtD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2bnlA           ESYQLTDQVYENISKEYIDILLLSVKDENAAESQIS-ELALRAVQIGLSKFLATALAEFWKRLYTKNDKE
3d1mB           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------ATYGKLTLKFIS---TTGKLPVPWPTLVTT
1e9sB           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2bkeA           -------------------------------------------------------------PGISQTVIN
2d2eA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dflA           -------------------------------------------------------------PGISQTVIN
1e4vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1d2zD           ------------------------------------------------------------------LSSK
1e9rE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------KYVLVELQGSNKKTITLM
3do6A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ISYLDMLVWPLMAIGFLFNTTQRGKVSYQRIENLLSQESPVQDPEFPLDGIENGRLEYAIDSFAFENEET
3b60A           XXXXXXXXXXXXXLTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVID-RATGDLEFRNVTFTYPGREV
3b5jA           ----------------------------------------------------HHDITFRNIRFRYKPDSP
3eiuA           LDSSADIVVVQVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVDINGAAMNPYARLPPKDFIQTGIS
2c61B           SADIVQVFIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLDINGAAMNPYARLPPKDFIQTGIS
3dmdC           ----------------------------DALREKIKQKLVGKKVRIGTDGKIIEEAVKEAVSEILETSRR
2dwoA           -------------------------------------------------------------WVPVDHR-P
2dwpA           ------------------------------------------------------------------TQSR
3cmvH           --------------------------------------------------MRLGEDRSMDVETISTGSLS
2akaB           -----------------------------------------------------------------RLQDA
2d3wB           -------------------------------------------------------------HVSVEDKAI
3cmvG           -------------------------------------------------------------STGSLSLDI
2c03B           ----------------IRRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAEVILATVYEALKEALG
2b8tA           ----------------------------------------------------------------------
3dtbB           DGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLL
2c03A           ----------------IRRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAEVILATVYEALKEALG
1dkiA           NGFV-IVSGDKRSPEILGYSTSGSFDVNGKENIASFMESYVEQIKENKKLVVKSLLDSKGIHYNQGNPYN
3dt2A           LHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGWLA
3eiuB           DSSVVQVFIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAANPYARLPPKDFIQTGIS
1d1cA           ----------------------------------------------------------------FAISDV
2cjwB           ----------------------------------------------------------------------
3b2qA           SSADIVVVQVFEIFTGETLKLPASVDLLGRILSGSGEPRDGGPQLLDINGAAMNPYARLPPKDFIQTGIS
1e69A           -----------------------------------------------------------LKKLYLKGFKS
1e9cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3dt4A           VLEAGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGWLL
3dmdB           ----------------------------DALREKIKQKLVGKKVRIGTDIIEEAVKEAVSEILETSRRID
3c95A           ----TRQPRLFDYLFTHRNKHKLMALIDVPQMKPLVHVSGFGAWRGNTSWVAPLAWHPENRNAMVDLAGD
1e98A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3cmvC           -----------------------------------------IEKQFGKGSIMRLGEDRSMDISTGSLSLD
2c04A           ----------------IRRALMDADVNLEVARDFVERVREEALGKQVLESLTPAEVILATVYEALKEALG
3dm5A           SVDEALIKELVRDI---QRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKHIIKIVYEELTKFLGT
3cmvA           ----------------------------------LGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDI
2ccjB           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1accA           ATIKAKENQLSQILAPNYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTGSNWSEVLPQIQETTARI
1e2dA           ----------------------------------------------------------------------
4dcgA           -------------------------VSLDKPFMYFEEIDN--ELDYEPESANE-------VAKKLPYQGQ
3cddF           GWTKIGITRSLEASGAFDLETYKFNDAQYKAFIEP--IKQGQACTVDIGGERVITGYVDDWVPSYDESTS
2c61A           LDSSADIVVVQVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVDINGAAMNPYARLPPKDFIQTGIS
3dt7A           LHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGWLA
3b2qB           ADIVVVQVFEGVIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYADFIQTGIS
2ahvA           -------------------------------------------------------------RINGRVPVS
2dr3A           --------------------------------------------------------------VKTGIPGV
1e9dA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ctsA           -------------------------------------------------------------ASSTNLKDI
2bifA           ----------------------------------------------------------------------
3bb1A           -------------------------------------------------------------APATQTKEL
2bbsA           --------------------------------------------------MENVTAFWEEGFEKAKGTPV
3czpB           ----------------------------------------------------------------------
2c4rL           EPSLEAAVDYGAERHGFLPLKEIAREYFPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGNPRAG
2czvA           ----------------------------------------------------------------------
3bgwA           YFQKRKAISIAQQIIENVNVKPIQEAVSELMEIEASGTDDDDGSIDEALVTVYEEIESADGTGVPSGFTE
3dt4C           LHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGWLA
1e4yA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e1qB           VVVFGNDVKRTGAIVDVPVGEELGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIK
2b8wA           -------------------------------------------------------------NGRLANPEA
3da4A           VQVV---YSFFQSPNMCLQALTQLEDYIKKHGASNPLTLQIISTNIGYFCADRNLVLHPGISVYDAYHF-
2axpA           ----------------------------------------------------------------------
2ck3C           GNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIK
2dr3E           --------------------------------------------------------------VKTGIPGV
3ec1A           IVDIFDFNGSFIPGLPRFAADNPILLVGNKADLLPRSVKYPKLLRWMRRMAEELGLCPVDVCLVSAAKGI
2cgtH           ---------------------KFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVS
1e2fA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2ahwD           -------------------------------------------------------------RINGRVPVS
3cddC           ----------------------------------------------------------------------
1cr4A           -------------------------------------------------------------GLLFSGCTG
2akaA           ----------------------------------------------------------------FAISDV
2cckA           ----------------------------------------------------------------------
2awnB           -------------------------------------------------------------TKAWGEVVV
1e3mA           ----------------------------------------------------------------------
1dg3A           -------------------------------------------------------------NGRLANPEA
2bkhA           NCSLMYL-NEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKGKSLGTMPPHVFAIADK
1e9sG           -------------------------------------------------------------TREKAKQVT
3d7wA           ---------------------------YERLRLRTDQQT---TGEEYFSFITLLRDYVSSGSFSNNIP-L
1e0jA           -------------------------------------------PDGVVSALSLRERIREHLGLLFSGCTG
2c9oC           --------------------------------------------------------------------VI
3czpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3bb1H           -------------------------------------------------------------APATQTKEL
3bb1B           -------------------------------------------------WSGINTF-----APATQTKLL
3cr7C           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2awnD           -------------------------------------------------------------TKAWGEVVV
421pA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3ed8A           TTLLQCFARYPDHMKQHFKSAMPEGYVQERTISFKDDGKYKTRAVVKFEGDTVNRIELKGTDFKED-GNI
2d0kA           ----------------------------------------------------------------------
1bmfC           GNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIK
1e9sF           -------------------------------------------------------------TREKAKQVT
1aroP           ----------------------------------------------------------------------
2bkiA           NCSLMYLNEATLLH-NIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKGKSLGTMPPHVFAIADK
2a30A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2bc9A           -------------------------------------------------------------NGRLANPEA
3d3kA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rA           -------------------------------------------------------------TREKAKQVT
2b92B           -------------------------------------------------------------NGRLANPEA
1dvrA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3c8uA           -------------------------------------------------------------TLAALCQGV
2bdtA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2awnC           -------------------------------------------------------------SVQLQNVTV
1dhjA           ----------------------------------------------------------------------
2bbsB           -------------------------------------------------------------MENVTAFWV
2aunA           ----------------------------------------------------------------------
3bb1E           -------------------------------------------------------------APATQTKLL
2awoC           -------------------------------------------------------------SVQLQNVTV
2d62A           -------------------------------------------------------------WKRFGDVTA
3bh0A           ---------------------------------------DGSIDEALVTVYEEIESADGNITGVPSGFTE
3cmxA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           --------------------------------------------------------------QEWTQQAA
3cmvE           --------------------------------------------------LGEDRSMDVETISTGSLSLD
1ak2A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2bnlB           TELIWQIDRFFSPINTEIFNQYSI--SWE-----------------------------------------
3bjdB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1e0jB           ------------------------------------------------ERIREHLSSEESVGLLFSGCTG
2d3wC           -------------------------------------------------------------HVSVEDKAI
2d4hB           --------------------------------------------------IENTNGRLMANPEALKI---
3di4A           ----------------------------------------------------------------------
3bb1F           -------------------------------------------------------------APATQTKLL
1e9sJ           -------------------------------------------------------------TREKAKQVT
1bg0A           ------------------------------------------------------------------MGAT
3bb1D           -------------------------------------------------------------APATQTKEL
2eg5G           --------------------------------------------------QLV--LAKVKPVLEQCVREL
2d3wD           -------------------------------------------------------------HVSVEDKAI
1e2kA           ----------------------------------------------------------------------
1e9sD           -------------------------------------------------------------TREKAKQVT
3bpbA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dm9B           ----------------------------DALREKIKQKLVGKKVRIGTDKGKIIEVKEAVSEILETSRRI
1eilA           ----------------------------------------------------------------------
2d4hA           -------------------------------------------------------------NGRLANPEA
2a2zB           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2dr3F           --------------------------------------------------------------VKTGIPGV
3bm2B           ----------------------------------------------------------------------
2bbtB           -------------------------------------------------------------KQNNNNTPV
3cr7D           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bnlC           IWQIDRFFSPINTEIFNQYS-----ISWE-----------------------------------------
3dm5B           SVDEALIKELVRDI---QRALIQADVNVRLVLQLTREIQRRALEEKPPAGI-SKKEHIIKIVYEELTKFL
1ek0A           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3bgwD           ------------------------------------------------------------------GFTE
3ch4B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3b9qA           FWNLAETD---RVLDELEEALLVSDFGPKITVRIVERLREDIMSGKLKSG--SEIKDALKESVLEMLAKS
3cmtD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1e9sE           -------------------------------------------------------------TREKAKQVT
3dauA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2bnlA           STELIWQIDRF--FSPINTEIFNQYSI-------------------------------------------
3d1mB           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awoA           -------------------------------------------------------------TKAWGEVVV
3dfqA           ----------------------------------------------------------------------
3cd9A           LVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGTLVNRIELKGIDFKEDGNIL
1e9sB           -------------------------------------------------------------TREKAKQVT
3bb1C           -------------------------------------------------------------APATQTKEL
2a1fF           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2b8wB           -------------------------------------------------------------NGRLANPEA
3cmvB           ----------------------------------------------------------------------
1e9sL           -------------------------------------------------------------TREKAKQVT
2bkeA           KLIEA----GYSSLETLAVASPQDLSVAAGIPLSTAQKIIKEARDALDIRTALEVKKERNVKKISTGSQA
2d2eA           -------------------------------------------------------------WASIDGETI
2cvfA           --------------------------------------------------------------LSTGTKSL
3bo6B           -------------------------------------------------------------MRQMPMSHF
1e9rF           -------------------------------------------------------------TREKAKQVT
1cr1A           -------------------------------------------------------------GLLFSGCTG
2bv7A           ----------------------------------------------------------------------
1cr2A           -------------------------------------------------------------GLLFSGCTG
3d31A           -------------------------------------------------------------SRKWKNF-S
1akeA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3cioD           -------------------------------------------------------VDNPADSAVEAVRAL
3dfnA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dflA           KLI----EAGYSSLETLAVASPQDLSVAAGIPLSTAQKIIKEARDALDIRFKTALEVKKERKISTGSQAL
1e4vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2d2fA           -------------------------------------------------------------WASIDGETI
1bglA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1b0uA           -------------------------------------------------------------HKRYGGHEV
1cjaA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------DFADQF
3dfnD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------ASALTR
1dyhA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
2d3wA           -------------------------------------------------------------HVSVEDKAI
1e2iB           ----------------------------------------------------------------------
1e9rG           -------------------------------------------------------------TREKAKQVT
6aldA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1e9sH           -------------------------------------------------------------TREKAKQVT
2czvB           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cr0A           -------------------------------------------------------------GLLFSGCTG
1e2jA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1e9sM           -------------------------------------------------------------TREKAKQVT
2dr3D           --------------------------------------------------------------VKTGIPGV
3bk7A           ----------------------------------------------------------------------
3dhwC           --------------------------------------------------LSNITKVFHQGTRTIQ---A
1e2lA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------VGSELT
3crmA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3cnlA           LRLVNTVVEVRDARAPFATSAYGVDFSRKETIILLNKVDIADEKTTKKWVEFFKKQGKRVITTHKGEPRK
1eamA           ----------------------------------------------------DNELDYEPAKLPYQGQKL
2b8tD           ----------------------------------------------------------------------
3bb1G           -------------------------------------------------------------APATQTKLL
3dfqC           ----------------------------------------------------------------------
1av6A           ----------------------------------VSLDKPFMYFEEI-----DNELDYEPEVAKKLPYQL
1e2mB           ----------------------------------------------------------------------
2dpyB           ---------------------------------------PAPDTLGALITPPFNPLQRTPIEHVLDTGVR
1drbA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1d2zD           YSRNT----ELRRVEDDIYRLAKILDENSCWRKLMSIIPKGMDVQACSGAGCLNFPAEIKKGFKYTAQDV
1e9rE           -------------------------------------------------------------TREKAKQVT
2a1fD           ----------------------------------------------------------------------
2d7vB           -------------------------EFDGGSKILASASPHVVPVPLSVEANVDPEEAFVAAHLVFLSIAA
1ckeA           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1e9rD           -------------------------------------------------------------TREKAKQVT
2dftA           ----------------------------------------------------------------------
2bbtA           --------------------------------------------------MENVTAFWEEGFEKAKGTPV
1e9sI           -------------------------------------------------------------TREKAKQVT
3cm0A           ----------------------------------------------------------------------
2awnA           -------------------------------------------------------------TKAWGEVVV
1dekB           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2dpyA           ---------------------------------------PAPDTLGALITPPFNPLQRTPIEHVLDTGVR
2e85B           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2d7vA           -----------------------------GSKILASASPHVVPVPLSVEANVDPEEAFVAAHLVFLSIAA
3dyoA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3cnnA           LRLVNTVVEVRDARAPF--ATSAYGVDFSRKETIILLNKVDIADEKTTKKWVEFFKKQGKRVITTHKGEP
3dfdA           -------------------------------------EKVYDLSFFPGQTIDAEEVEVPISKRFVDKEGN
1c9kC           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e9rB           -------------------------------------------------------------TREKAKQVT
1e2hA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2c9gA           -------YSPGEASTQTINLDDRSHWGGDLKTILHTNMPNVNEFMFTNK-FKARVMVSRSLTKDKQVELK
3bjqB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1d6aA           LRRNNLYVMGYSDPFFNDISGTERQDVETTLCPNANSRVSKNINFDSTLESKAGVKSRSQVQLGIQILDS
3do6A           -------------------------------------------------------------YIAKIDHRF
1cjvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
2awoD           -------------------------------------------------------------TKAWGEVVV
3cphA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2a5vA           ------------------------------------------------------------------DSAV
1dw9A           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e9sA           -------------------------------------------------------------TREKAKQVT
2cbzA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------FLGKEH
2bboA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2a5vB           ------------------------------------------------------------------DSAV
2c9oB           --------------------------------------------------------------------VI
3e70C           ----------------------------DALREKIKQKLVGKKVRIGGKIIEAVKEAVSEILETSRRI-D
3cbqA           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LTDIHFSLAKGQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIXLNGHDIRDYRLTDLRSLMGYVPQDQFL
3b60A           LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALVSQNVHL
3b5jA           LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVL
3eiuA           TIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGINEEAQYFMSDFEKTGAL
2c61B           TIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGTNEEAQYFMSDFEKTGAL
3dmdC           LIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVI
2dwoA           SLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEE
2dwpA           VQKIWVPVDHRNSIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEE
3cmvH           LDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGV-DIDNLLCS
2akaB           FSAIGQNADLLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKK
2d3wB           LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEGEGIFMAFQYPVE
3cmvG           A-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP--IYARKLGVDIDNLLC
2c03B           GEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVL
2b8tA           ----------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEV
3dtbB           ILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVA
2c03A           GEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVL
1dkiA           LLTPVEKVKPGEQVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSN---------NPYFNHPKNL
3dt2A           ILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVA
3eiuB           TIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEQYFMSDFEKTGAL
1d1cA           AYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQILQANPILEAFGNAKTTRNN
2cjwB           -----FGM-TYYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATIILLDMWENHDHMQVGDAYL
3b2qA           TIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDFEKTGA
1e69A           FGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGSAYVELVFEENGEEITV
1e9cA           ---------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVED
1bifA           ----------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEE
3dt4A           ILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVA
3dmdB           LIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVI
3c95A           ISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNENPQVREKVVAIFAESDN
1e98A           ---------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE-
2ccgA           -------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRT
3cmvC           IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA-RKLGVDIDNLLCS
2c04A           GEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVL
3dm5A           EAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVF
3cmvA           A-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGV-DIDNLLCS
2ccjB           -------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRT
2ccgB           ----------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRT
1e9fA           ---------RGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTE--IGKLLSSYLQKKSDV
2c9yA           ----------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLV
1accA           IFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKGFNEPNGNLQYQGKDITEFDFN---------------
1e2dA           ---------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVED
4dcgA           LKLLLFFLSKILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVI
3cddF           VSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQHELLARLAKQRGVL
2c61A           TIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDFEKTGA
3dt7A           ILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVA
3b2qB           TIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDFEKTGA
2ahvA           AQEAVNYIPDEATLCVLGAGLEATTLITALADKYISPTGLGDRADRGISPLAQEGLVKWALCGHWGQSPR
2dr3A           DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEE
1e9dA           ---------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE-
2a5gA           ---------KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRP
2bofX           ----------------------------------VNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQG---
2ctsA           LADLIPKEQIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRGYSIPECQKMLPKAKG
2bifA           ------------LIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEE
3bb1A           LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLI
2bbsA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVS
3czpB           LIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLWRFWIPARRQFT
2c4rL           GISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAAESRPAPFLIHQESNV
2czvA           VKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLLIYVESNDLR
3bgwA           LDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLIVTAGSINAQKI
3dt4C           ILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVA
1e4yA           -------------IILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLV
2a2zD           ---------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMWSFTFQTYAC
1e1qB           AVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLD
2b8wA           LKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWVPHPKKPGHILVLLDTEG
3da4A           --AKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLKISPMKSGVVGTFPVSTKF
2axpA           -------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFELADEDNVIIDRFV
2ck3C           AVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLT
2dr3E           DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEE
3ec1A           VMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPGTTLDMIEIPLESGATLYDTPG
2cgtH           AREIELDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDSKAIAQVGTISA
1e2fA           ---------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVED
3a1wA           ------------KVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYS
2ahwD           AQEAVNYIPDEATLCVLGAGLEATTLITALADKYISPTGLGDRADRGISPLAQEGLVKWALCGHWGQSPR
3cddC           ------------VLKAGGKIYQGWTKIGITRSLETYKFQYKAFIEPIKQGQACTVDIGGERVITGYVDDW
1cr4A           INDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQ
2akaA           AYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTT
2cckA           -------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEDMDIRTEA
2awnB           SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYP
1e3mA           --------------------LVNLAERAYTLNYTCPTFIDKPGIRITEGRH-PVVEQVLNEPFIANPLNL
1dg3A           LKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGD
2bkhA           AFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEA---NPLLEAFGNAKTVRN
1e9sG           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
3d7wA           LRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFLSDA---------PAGAETQD
1e0jA           INDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQ
2c9oC           VELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGL
3czpA           LIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLWRFWRHIPARRQ
2a2zA           ---------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT
2aumA           ---------------------------------------------------------------SSDQTWQ
2a30D           ---------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT
3bb1H           LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLI
3bb1B           LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVSRSRAGFTLNIIDTPGLIE
3cr7C           ---------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKD--LGFSEADRNE
1e3mB           --------------------------LVNLAERAYTLNYTCPTFIDKPGIR--ITEGRPVVEQVLNEPFI
2axzC           ----------------------------------------------------------------------
2b8tB           ----------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKILPSVE------VESAPEILNY
2awnD           SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVEPSVFLLD
421pA           ---------TEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQE
3dffA           ------------------------------------------------------------VLVYTVFAGA
3b85A           QKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGEKLGFLPGDPYLRPLHD
3ed8A           LGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQNTPIGDGPVLL---PDNHYL
2d0kA           ----------------------------------------------------------------------
1bmfC           AVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLT
1e9sF           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
1aroP           ----------------------------------------------------------------------
2bkiA           AFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANP---LLEAFGNAKTVRN
2a30A           ---------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT
1e2gA           ---------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLL--SSYLQKKSDV
2d4uA           --------------GPLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGLQTRNTLNRAGIRYMMDQNIG
3cbnA           --------------------------------------RYTLRARGHPNVT----AGHRTTFEVTVDPEI
2bc9A           LKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLD
3d3kA           --AEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALGPHVKGAQGISCGRH-----LANHDVQVILF
2bhjA           -------------------------------VRIKNWGSGEILHDTLHHKATSCSIMNKSLTRGPRDKPT
2ausC           ----------------------------------------------------------------------
1e9rA           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
2b92B           LKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKHILVLLDTEG
1dvrA           --------SESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLV
2a5jA           SSGLVPRGSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDGKQIKLQIWDTAGQESFRS
3adkA           ---MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLV
3c8uA           LERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPDGFHLDNRL--LEPRGLLPRKGAP
2bdtA           -------------YIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGGYRPPWESDELLALTWKNA
1e2hB           -------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGTTQHRLDQGEISAGDA
2awnC           SKDINLDIHEGEFVVFVGPSGC------------------------GKSTLLRMIAGLGVGMVFQSYALY
1dhjA           ----------------------------------------------------------------------
2bbsB           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVS
2aunA           ---------------------------------------------------------------SSDQTWQ
3bb1E           LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLI
2awoC           SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVALYPHLSV
2d62A           VKDLSLEIKDGEFLVLLGPSGCGKTTTLRILEEPTRGQIYIEDNLVADPEKGVFVPPKERDVAVFQSYAL
3bh0A           LDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLIVTAGSI-----
3cmxA           ----AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARK--LGVDIDNLCS
1ai4B           ---LTINWYYADVNGNIGYVHTGAYPDRQMNPKVYNPQSGYIANWNNSPQKDYPA--SDLFAFLWGGADR
3d3qA           ---------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTTEEEGIPHYIDIL
1e3aB           KQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMNPKVYNPQSGYIAFLW
3cmvE           IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKL-GVDIDNLLCS
1ak2A           ---------KGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLV
2b8tC           ----------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSRTGTSLSVEVESAPEILNY
3cddD           --EIVLKAGGKIYQGWTKIGITEASGAFDLTYKFNDAQYKAFIEPIKQGQACTV-DIGGERVITGYVDDW
1e6cA           -----------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVEGWPGFRRRESEA
2a30B           ---------RIKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVQMMYEKPERWSFTFQTYCL
2bnlB           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1culC           ----------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVEL
2bx2L           ------------------------------------------------------------APFLIHQESN
3bczC           --------GSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIF
1e59A           VTKLVL-VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLNVLDELDQAWL
1e0jB           INDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQ
2d3wC           LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQY
2d4hB           LSAITQP---MVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLDTEGLGQNDSWIFALAVLLSSTF
3di4A           REGRCFEVKAGQFFRISSVEGPQVG-----DLNLHNLHDLTERFFSGKTRALHGTHVTTGERLWSNLPYL
3bb1F           LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLI
1e9sJ           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRD--KDIILNPYDQ
1bg0A           LLDVIQSGVEDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKHPPKQWGDINTLVGLDPAGQFII
3bb1D           LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLI
2eg5G           LRANLPNINKCIKVADLGCASGPNTLLTQSIDKVGQLERPTIQIFLNDLFPNDFNSVFKLLPSYRKLEKE
2d3wD           LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFVS
1e2kA           -------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEI
1e9sD           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
3bpbA           LGKPDYAKALEQHNAYIRALQVDITLLPPDERSVFVEDPVLCTSRCAIITRPGAESRRGETEIIEETVQR
3clvA           ------EKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTNENLCNIKFDIWDTAGQERY
3dm9B           DLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR---------AGAIEQLEEH
1eilA           ----------------------------------------------------------------------
2d4hA           LKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMWCVPHPKPGHILVLLDTEGL
2a2zB           ---------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT
3ecpA           ----------------------------------------------------ALHRAADWAKSVFSSAAL
3d3qB           ---------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTTEEEGIPHYIDIL
2dr3F           DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEE
3bm2B           -----------------------------------------------------------------LELLI
2bbtB           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVS
3cr7D           ---------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKD--LGFSEADRNE
2dr3B           DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEE
1cs4C           ----------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVEL
2bhvD           ---------------------------------------------LRTITADKMIPAFLITPISSQIAGK
2bnlC           ----------------------------------------------------------------------
3dm5B           EAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVF
1ek0A           -------------LVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQ
3dfnC           ----------------------------------------------------------------------
1cjtC           ----------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAALVPPVELANP
2cckB           -------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRLEGDMDIRTEAML
3bgwD           LDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGK---------KENIKRLIVT
3ch4B           --MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQYKEAFRKD
1dhiA           ----------------------------------------------------------------------
3b9qA           KTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFRAAASDQLEIWAERTGCEIV
3cmtD           -------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP-IYARKLGVDIDNLLCS
3a00A           -----------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYN-FVSVDEFK
2c0bL           --LMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAPFLIHQESN
2dr3C           DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEE
1e2iA           -------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGAVVMTSAQIT
1dekA           -------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLTRKEF
3be4A           -------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKNGIGLEAKSIIESGNFVGD
1e9sE           VAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
3dauA           ----------------------------------------------------------------------
3cr7B           ---------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENR
3b55A           ----------------------------------------------------------------------
2bwjA           ---FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST---GELLREELASESKLIRDIMERGDLV
2bnlA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3cr7A           ---------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENI
5dfrA           ----------------------------------------------------------------------
2awoA           SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYP
3dfqA           ----------------------------------------------------------------------
3cd9A           KLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTCS--A
1e9sB           VAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
3bb1C           LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLI
2a1fF           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2b8wB           LKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLD
3cmvB           --LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCA-FIDAEHALDPIYARKLGVDIDNLLCS
1e9sL           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
2bkeA           LDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEGTFRWERIENAKALGL
2d2eA           LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPDERARKGLFLAFQY
2cvfA           DSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPE--RLVQMAETRGLNPEALS
3bo6B           REALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDKFHISVQREQVPQAFQALS
1e9rF           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
1cr1A           INDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVG-LAMLEESVEETAEDLIGLHNRVRL-
2bv7A           LGSPVFTPIKADISGVYDTNPTKFRTLQNILEVEKEMYGAEWPKVGATLALMW-----------LKRGLR
1cr2A           INDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQ
3d31A           LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDL--SPEKHDIAFVYQNYSL
1akeA           -------------IILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLV
3dfpC           ----------------------------------------------------------------------
3cioD           RTSLHFETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYL
3dfnA           ----------------------------------------------------------------------
2bhvA           ---------------------------------------------LRTITADKMIPAFLITPISSQIAGK
2dflA           DGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEGTFRWERIENMAKALG
1e4vA           -------------IILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLV
1d6jA           SERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF--GLNKDLGFSEADRNE
2c7cH           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1cfrA           -------------MDIISKSGEGNKYTINSAIAHIDINTTEFSKVLSGLRDF-INDEAIRLGGKISDGSF
2d2fA           LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPDERARKGFQYPVEV
1bglA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1b0uA           LKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADKNQLRLL
1cjaA           ----------------------------------------------SDRLPIAWTNEGNLDNIMLSERGA
1ckvA           FADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGKIEVDCDEISELLGRQFNVYDF
3dfnD           ----------------------------------------------------------------------
4atjA           -----------------------RDTIVNELRSDPRIAASILRLHFEDCFVNGCDA----SILLDNTTSF
3dlbB           ------WVEGLAVYRREHARGPGWRVLGG-----------------AVLDLWVSDSGAFLLEVDPAYRIL
1d6jB           SERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRAYRLDGDNIRFGLNKDLG----FSEADRNE
1dyhA           ---------------------------------------------------------------------I
1afrA           HVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPAMLNTLDGVRDETGASPTSWAIW
3dfpD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3a00B           -----------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFV-SVDEFK
3dfoD           ----------------------------------------------------------------------
3c85A           --------------------------------QLINPGHAQVLILGGRIGTGAYDELRARYGKISLREEA
2d3wA           LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTLALSPEDRAGEGIFMAFQYPVEIPGVS
1e2iB           -------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV--------LGASETIANI
1e9rG           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
6aldA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2aumB           --------------------------------------------------------------------WQ
1draA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2ccjA           ------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRT
2aunB           ----------------------------------------------------------------------
3c15C           ---------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVE
3cueF           -------YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDGKTVKLQI-WDTAGQERFR
1e9sH           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
2czvB           --AYELAKEWFEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTVQKFKSYLIYVESNDLR
3dymA           ----------------------------------------------------------------------
1cr0A           INDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV--------EETAEDLIGL
1e2jA           -------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVTYWRVLGASETIANIYTTQHRLDQGEISAGDA
4dfrA           ----------------------------------------------------------------------
1e9sM           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
2dr3D           DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEE
3bk7A           LEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYKP------------QYIKAE
3dhwC           LNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQH
1e2lA           -------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIANIQHRLDQGEISAGDA-
2bjbA           VSGRIEPGPGARVD--CGLAGT----VLRFVPPLAALGSVPVTFDGDQARGRPIAPLLDALRELG-----
3crmA           --------SLPPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMDIGTAKPSRELLARYPHRL
3cmwC           --LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARK--LGVDIDNLCS
2boeX           ----------------------------------------------------------------------
3cnlA           VLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLDTPGILYKNIFSEDLAAKLLLVGSLP
1eamA           LLGELFFLSKILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVD
2b8tD           ----------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVKPKSIRNIQSRTGTSLPSVEVESAPE
3bb1G           LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLI
3dfqC           ----------------------------------------------------------------------
1av6A           LGELFF-LSKILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVD
1e2mB           -------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDYWRVLGASETIANIYTTQHRLDQGEISAGDA
2dpyB           AINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGPDGRARSVV
1drbA           ----------------------------------------------------------------------
2anbA           --------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFK
1d2zD           IDEAANRLPPDQSKSQTSGKLNERPTVGVLLQLLVQAELADFVALDFLNES---------TPARPVDGPG
1e9rE           VAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
2a1fD           ----------------------------------------------------------------------
2d7vB           KQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQL---EKHHLAHENCFIAN----
1ckeA           --------AIAPVITIDGPSGAGKGTLCKAMAEAL----QWHLLDSGAI--YRVLALAALHHHVASEDAL
2ancF           --------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGAQQIRQKM
1cjuC           ----------THRLLLLGAGESGKSTIVKQMRILHVNGEKAT--KVQDIKNNLKEAIETIVAAMSNLVPP
1e9rD           VAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
2dftA           -------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIE
2bbtA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVS
1e9sI           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
3cm0A           ----------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVAR-GTPLGERVRPIMERGDL
2awnA           SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAER-------------
1dekB           -------------IFLSGVKRSGKDTTADFIMSNYSAVKYQL-----------AGPIKDALAYAWGVFAA
2cdnA           --------GSHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLV
1d8jA           ----------------------------------------------------------------------
1e2kB           -------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVLGASETIANIYTTQHRLDQGEISAGDA
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2dpyA           AINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGPDGRARSVV
2e85B           ----------------------------------------------------------------------
3c14C           ----------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNL--KEAIETIVAAMSNLVPP
2ancD           ---------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFK
2b0lC           ----------------------------------------------------------------------
2d7vA           KQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQL---EKHHLAHENCFIAN----
3dyoA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2an9A           --------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFK
3cmuA           ----AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARK--LGVDIDLLCS
2dftC           -------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIE
3bwdD           ---------RFIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDYNRLRP-LSYRGADVFI
2bhvC           ---------------------------------------------LRTITADKMIPAFLITPISSQIAGK
1e2nB           -------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVLGASETIANIYTTQHRLDQGEISAGDA
1bccF           --------------------------------------------------RWLEGIRKWYYNAAGNKYGL
3e8aC           ----------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKE--AIETIVAAMSNLVPP
1e2nA           -------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYRVLGASETIANIYTTQHRLDQ
2ancB           --------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFK
3cnnA           VLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDTPGI--LYKNIFSEDLAAK
3dfdA           VVPFIFKAITTDRIDELEKENTTKEL-------DSQRFYARIAVETTVYPTFKAKELREAYKTEDPVEVA
1c9kC           -------------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDG---RPAHWRTARHLDTLI
3c7kA           -------------LLLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEY-
1e9rB           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
1e2hA           -------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEIS
2b0lB           ----------------------------------------------------------------------
2c9gA           YEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLESDIGVKFDTRNFRLG--------------
3bjqB           ----------------------------------------------------------------------
1e2jB           -------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLD
1d6aA           ISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIE-NQVKTNFNRAFNPNPKVLNLQETWGKISTAIHDAK-
3do6A           LKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLREPS---------------------
1cjvC           ----------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEA----IETIVAAMSNLVPP
3bs4A           -------KKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPLQLIIRILSRFGVDVIKYLE
1e2mA           -------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVTYWRVLGASETIANIYTTQHRLDQGEISAGDA
1dp0A           ----------------------------------------------------------------------
2awoD           SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNRGVGMVEPSVFLLDEPLDAA
3cphA           -------------ILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQ
2c95B           -------LKKTNIIFVVGGPGSGKGTQCEKIVQKYG-------YTHLSTGDLLRSEVSSGSARKLSEIME
1delA           -------------IFLSGVKRSGKDTTADFIMSNYS---AVKYQLAGPIKDA----LAYAWGVFAANTDY
1azsC           ---------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKE--AIETIVAAMSNLVPP
2d4uB           ---------------------------------------QQSTLNGSWLLQTRNTLNRAGIRYMMDQNNI
2ax4A           ---------RGCTVWLTGLSGAGKTTISFALEEYVSHAIPCYSLDGDNVRHG----LNRNLGFSPGDREE
3dkvA           ---------------LMGLPGAGKGTQAERIVEKYGI--PHISTGDMFRAAKEETPLGLEAKSYIDGELV
2ax4B           ---------RGCTVWLTGLSGAGKTTISFALEEYVSHAIPCYSLDGDNVRNRNLGFSPGDREENIRAKLF
3dsrB           --DGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFVVFAAMGITNEEAQYFMSDFEKTGAL
2a5vA           LGSIEYAVTNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV--------RDVVERVAPSVLLGRRDGLS
1dw9A           --ILLSKAKKDLSFAIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLSILLLQIPLRGCIDDRIPT
2c5mD           ----------------------------------------------------------------------
2bwjB           -----EDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST----------------------------
1e9sA           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
2cbzA           ----------------------------------------------------------------------
2bwjD           MEDLR----KCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST----------------------------
3brwA           FNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRF
2bboA           ----------------------------------------------------------------------
1e2lB           -------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDD--IVYVPEPMTYWRVLGASETIANIFTTQHR
1chdA           ----------------------------------------------------------------------
2bwjF           MEDLR----KCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST----------------------------
3b85B           --HYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGEKLGFLPDPYLRPLHDA
2aexA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2a5vB           LGSIEYAVTNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV--------RDVVERVAPSVLLGRRDGLS
2c9oB           VELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLM---------
3e70C           LIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVI
3cbqA           -------------VMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQ
1delB           -------------IFLSGVKRSGKDTTADFIMSNYSA---VKYQLAGPIKDALAYAWGVFAANTDYPCLT
3dmdA           ----------------------------------------------------------------------
2bwjC           MEDLR----KCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST---GELLREELASEERSKLIRDIMERGD
3dvlD           -------LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTEETPQDIIKNARSFGWDLAKLVD
2dwqB           ------------AVGIVGLPNVGKSTLFNALTRANALAKNVGVVPLEDERLYALQRTFAKGERVPPV---


                         .         .         +         .         .         .         .:490
query           FATSILDNIRFGNPNLPLSAVVEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRLAMSRAMILEP
3b60A           FNDTVANNIAYARTEESREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDS
3b5jA           LNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNP
3eiuA           ERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVTDLATLYERAGIVKGAKGSVTQIPILSMPGD
2c61B           ERAVVFLNLADDPAVERIVTPRMALTAAEYLAGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGD
3dmdC           KHSYGADPAAV---------------------AYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIA
2dwoA           AMKVRKQCALAALRDV--------------------KSYLAKEGGQIAVFDATNTTRERRHMILHFAKEN
2dwpA           AMKVRKQCAL--------------------AALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKEN
3cmvH           QPDTGEQALEIC-DALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLARMMSQAMRKLAGNLKQSNT
2akaB           FTDFEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKE
2d3wB           IPGVLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEP
3cmvG           SQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLARMMSQAMRKLAGNLKQSNT
2c03B           EVMDGESPE---------------------SIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK
2b8tA           ESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVVVIISGLDKNFKGEPFGPIAKLFTYADKITKLT
3dtbB           PGTSVKTNPNAIKTIQKNTIFTNVAETSD--GGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNS
2c03A           EVMDGESPE---------------------SIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK
1dkiA           FAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGISVDMDYGPSSGSAGSSRVQRALKENFGYNQS
3dt2A           PGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITS--WKNKEWRPQDEEPCAHPNS
3eiuB           ERAVVFLNLADDPAVERIVTPRMALTAAMGAAGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGD
1d1cA           NSSRFGKFIEIQFNNAGFIS--GASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPE
2cjwB           IVYSITDRASFEKASELRIQLRRARQTE----DIPIILVGNKSDLVRREVSVSEGRAAVVFDCKFIETSA
3b2qA           L---ERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARN---EV
1e69A           ARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSRKPGRRDQKLSLLSGGEKALVGLALLEIKPS
1e9cA           H-------SVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGLPKPD
1bifA           GLKIR--------------------KQCALAALNDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQN
3dt4A           PGTSVKTNPNAIKTIQKNTIFTNVAETS--DGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNS
3dmdB           KHSYGADPAAV---------------------AYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIA
3c95A           VDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFEKLLFNYRARNFPGTLDYAEQQRWLEHRRQVFTP
1e98A           ------DHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPD
2ccgA           EAMLFAASRREHLV--------LKVIPALKEGKVVLC----DRYIDSSLAYQGYARGIGVEEVRALNEFA
3cmvC           QPDTGEQALEICDALARSGAV------DVIVVDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLL
2c04A           EVMDGESPE---------------------SIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK
3dm5A           GNPQEKDAIK-----------------LAKEGVDYFKSKGVDIIIVD----TAGRHKEDKALIEEMKQIS
3cmvA           QPDTGEQALEICD---------ALARSGAVDVIVVDSVAALTPKAEIGLAARMMSQAMRKLAGNLKQSNT
2ccjB           E-----AMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLA-------YQGYARGIGVEEVRALNEFA
2ccgB           EAMLFAASRREHLVL------------KVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFA
1e9fA           EDHSVHLLFSANRWEQVPLI-----KEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPD
2c9yA           SDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLI
1accA           FDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR--------NNIAVGADESVVKEA
1e2dA           HSVHL-------LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPD
4dcgA           KKQLHPSKIILISDVLSNYALQNVMISILNPVASSLKWRCPFPAQWIKDFYIPHGNKMLQPFAPSYSAEM
3cddF           LTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTI----KAAGIKADVTDSEIGRYRP
2c61A           LERAVVFLNLADDPAV---ERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARNEVPGR
3dt7A           PGTSVKTNPNAIKTIQKNTIF--TNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNS
3b2qB           LEAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVTDLATLYERAGIVKGAKGSVTQIPILSMPGD
2ahvA           ISDLAEQNKIIAYNY-PQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDN
2dr3A           KGM-------------------------FAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINA
1e9dA           ------DHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGLPKPD
2a5gA           LWRHYYTGTQGLIFVVDCARIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIR
2bofX           ---TWFAHHNPGQITGQVDALMSAAQAA----GKIPILVVSNAPGRDCGAPSHSAYRSWIDEFAAGLKNR
2ctsA           GEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESN
2bifA           GLKIRKQCALAA--------------------LNDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQN
3bb1A           EGGYINDMALNIIKSFLLDKTIDV--LLYVDRLDAYRVDNLDKLVAKDSFGKGIWNKAIVALTHAQFSPP
2bbsA           YDEYRYRSVIK-------------------ACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDA
3czpB           IFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQERF-KEREKTPYK
2c4rL           IVRAFRDYLRQDIGEILID-NPKVLELARQHIAALGRP-DFSSKIKLYTGEIPLFSHYQIESQIESAFQR
2czvA           VIRYSIEKGVDAIISPWVNRKDPGIDHVLA--KLMVKKNVALGFSLRPLLYSNPYERANKAWKLVEKYKV
3bgwA           KAARRDFASEDWGKL---------------SMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKR
3dt4C           PGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAP--GVTITSWKNKEWRPQDEEPCAHPNS
1e4yA           TDELVIA-------------------------LVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
2a2zD           LSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTI----YQDWHDWMNNQFGQSLELD
1e1qB           ADAMKYTIVVSATASDAAPLQYLAPYSGCIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE
2b8wA           LGDVEKGDNQNDSWIFTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSVSFFPDFVWTLRDFSLDLEADG
3da4A           THATGDYNVITGAYGSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGAMFSGKEYQILLPGEIHIKES
2axpA           YSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVLRVRGDEYIEGKDIDSILELYREVSNA
2ck3C           DA----------------------------DAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKH
2dr3E           KGMFAMVDAFTAGIGKEYEDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKTGC
3ec1A           IINHHQMAHFVDARDL---KIITPKREIHPRVYQLNEGQTLFFGGLARLDYIKGGRRSFVCYMANELTVH
2cgtH           NSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGY----LSPYFINKPETGAVELESP
1e2fA           HSVHLLFSANRWEQVPL-------IKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPD
3a1wA           LGYSSIDEKIARDYL-LKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDRYELQK
2ahwD           ISDLAEQNKII-AYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDN
3cddC           VPSYDESTITISVSGRDKTADLVDCSIDYPSGQIADIKVIVNTDVGEPFQRIEQGETPHELLARLAK-QR
1cr4A           SDSLKREIIEN----------------GKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGC
2akaA           NNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPES
2cckA           MLFAASRREH------------------LVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAL
2awnB           HLSVAENMSFGLKLAGA------KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEP
1e3mA           SPQRRLIITGPNGGKSTYRQTALI----ALAYIGSYVPAQKVEIGPIDRIFTRVGFVETETANILHNATE
1dg3A           NQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDSDFVSFFPDFVWTLRDFSLDL
2bkhA           NNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPNF
1e9sG           KGWSFFNEIRND------------YDWQRYALS-------------VVPRGKTDEAEEWASYGRLLLRET
3d7wA           FSGTTSSSQPFNGSY---------PDLERYAGHRDQIPLGIDQL-IQSVTALRFPGGQTKTQ--ARSILI
1e0jA           SDSLKREIIENGKFD---------QWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDH
2c9oC           RIKETKKKE-IIQDVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSI
3czpA           FTIFDRYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQERF-KEREKTPYK
2a2zA           FQTYACLSRIRAQ----LASLNGKEKPVLFFERSVYSDRYIFASNLY---ESECMNETEWTIYQDWHDWM
2aumA           PIDGRVALIAPASAIAT-----EVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLEDLHNAFDMP
2a30D           FQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNESECMNETEWTIYQDWHDWMNNQFGQSLELD
3bb1H           EGGYINDMALNIIKSFLLDKTIDVL--LYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAI--------
3bb1B           GGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPP
3cr7C           NIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGDPKGLYKKAREGVIKEFTGISAPYE-AP
1e3mB           ANLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGTFVETETANILHNATE
2axzC           -------------------------LYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPYPIVDSFGKDY
2b8tB           IMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLT
2awnD           EPLSNLDAALRVQMRIE---ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP
421pA           EYSAMRDQYMRTGEGFFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR
3dffA           YSPAAQRHTIWG---LAPDDDAVLYRRKED-IAALDHLRVAHRHGRFLDSIYRKLPDGRWLTAHVEGRQK
3b85A           ALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTLTRLGFGSKVVTGDGLRLVRHILRGV
3ed8A           SYQTVLSKDPNEKRD--HMVLLEFVTAAGI----------------------------------------
2d0kA           ------------SLIA---ALAVDRVIGNENALPWNLPADLAWKRNTLNKPVIYGRHTWESIGRPLPGRK
1bmfC           DA----------------------------DAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKH
1e9sF           KGWSFFNEIRNDYDWQRYALSVVPRG-------------------------KTDEAEEWASYGRLLLRET
1aroP           ---NDFSDIELAA--IPFNTLADHYGERLAREQLALEHESYEMGEAR----FRKMFERQLLITTLLPKMI
2bkiA           NNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDN
2a30A           FQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESTIYQDWHDWMNNQFGQSLELD
1e2gA           EDHSVHLLFSANRWEQVPLI-----KEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPD
2d4uA           SGSTVAELMESASISLKQAEKNWADYEALPRDPR--QSTAAAAEIKRNYDIYHNALAELIQLLGAGKINE
3cbnA           ---GETADCIIGVSSSDSISEKRAIARESLVRVILRTENGYDEIRGYGHPELTLDHPTDIVCRKSDYICS
2bc9A           TEGLGDVEKGDNQNDSWI------------------FALAVLLSSTFVYNSIGTINQQAMDQLYYVTELT
3d3kA           LPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRDQPWYKAAVAWANQNRA
2bhjA           PEELLPHAIEFIQYYGSFKEAKIEEHLARL-EAVTKEI-ETTGTYQLTLDELIFATKMAWRNAPRCIGRI
2ausC           ---VIVKDDKAETNPKWGFPPDKRPIELHIQYGVLDKPPGP----------TSHEVVAWIKRILNLEKAG
1e9rA           KGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETA------KKLALIGTPSMRELFHWT
2b92B           LGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYHRIRSKSSFVSFFPDFVWTLRDFSLDL
1dvrA           SDDIMVNMIKDELTNNPCKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLI
2a5jA           ITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHS-SSNMVIMLIGNKSDLESRRDVKREEGEAFAR
3adkA           PLETVLDML---RDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGE
3c8uA           ETFDFEGFQRLCHA---------LKHQERVIYPLFDRA---------RDIAIAGAA-EVGPECRVAIIEG
2bdtA           QNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREE-----LLRRDALRKKGE--RCLELVEEF
1e2hB           AVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF
2awnC           PHLSVAENMSFGLKLAGAKKE-VINQRVNQVAEVL----QLAHLLDRKPKALSGGQRQRVAIGRTLVAEP
1dhjA           ---------------------------------------LAWFKRNTLDKPVIMGRHTWESIGRPLPGRK
2bbsB           YDEYRYRSVIKAC---------------QLEEDISKFAEKDN--IVLGGITLSGGQRARISLARAVYKDA
2aunA           PIDGRVALIAPASAIAT-----EVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLEDLHNAFDMP
3bb1E           EGGYINDMALNIIKSFLLDKTIDVLLYVDRLDARVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPP
2awoC           AENMSFGLKLAGAKK----------EVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEP
2d62A           YPHTVYDNIAFPLKL------RKVPKQEIDKRVREVAELGLTELLNRKPRELSGGQRQRVALGRAIIRRP
3bh0A           ----NAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMID
3cmxA           QPDTGEQALEICDALARSGAVVAALTPKAEARMMSQAMRKLAGNLKQSNTQIRNPETTTGGNALKFY-AS
1ai4B           V-----TEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDG
3d3qA           PPDASFSAYEFKKRAEKYIKDIVPIIAGGTGLYIQSLLYNYA-FEISEDKKQVKLKEYLASFDKESAKDI
1e3aB           GGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDG
3cmvE           QPDTGEQALEICDALARSGAV------DVIVVDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLL
1ak2A           SDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLI
2b8tC           IMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLT
3cddD           VPSYDESTITISVSGRDKTADLVDCSIDYPSGKPFGIKVIVNTDVGEPFQRIEQGETPHELLARLAK-QR
1e6cA           LQATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALASLQAHQRPTLTGRPIAEEMEAVLRER
2a30B           SRIRAQLASLND---AEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELD
2bnlB           ----------------------------------------------------------------------
3bjdB           ---AAYQQLLYVL-SLSDDVATAQTWLARAYRVEERFPAA-DLSRALSEEDFQKRLEQEIAAQSRERHPS
1culC           ANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVI----
2bx2L           VIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPD-FSSKIKLYTGEIPLFSHYQIESQIESAFQR
3bczC           ILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEHSIEHLPYTAKAESHKD
1e59A           PEKSWKLNERHYGALQGLNK---AETAEKYGDEQVKQW--RRGFAVTPPELTKDDERYPGHDPRYAKLSE
1e0jB           SDSLKREIIENGK---------FDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDH
2d3wC           PVEIPQFFLQTALNAVRSYRGQETLDRDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEP
2d4hB           VYNSIGTINQQAMDQLYYVTELTSKSSDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTSLKLKK
3di4A           RPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGNLTRALADHTGLPLHEAELVHDVLNVFCTG
3bb1F           EGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPP
1e9sJ           RT-----------------------KGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
1bg0A           STRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEDELKGTYYPLTGMSKATQQQLIDDHFLFKEG
3bb1D           EGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRPDGLPYDEFFSKRSEALLQVVRSGASLKKDAASDI
2eg5G           NGRKIGSCLIGAMPGSFYSESMHFLHSCYCLQWLSQVPSGLVTEIGTNKGSIYSSKASRLPVQKAYLDQF
2d3wD           NQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEP
1e2kA           SAGDAAVVMT----SAQITMGMPYAVTDAVLAP-----------------HIGGEAGPPPALTLIFDRHP
1e9sD           KGWSFFNEIRNDYD----------------WQRYALSVVPRGK---------TDEAEEWASYGRLLLRET
3bpbA           F----------YPGKVERIEAPGTVEAGDIMMVGDHFYIGESARTNAEGARQMIAILEKHGLSGSVVRLE
3clvA           ASIVPLYYRGATCAIVVFD---ISNSNTLDRAKTWVNQLKISSNYIIILVANKIDKNFQVDILEVQKYAQ
3dm9B           AKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVL--------------IDTAGRSETNRNLDEKKIA
1eilA           -------------------SIERLGYLGFAVKDVPAWDHFLTKSVGL----MAAGSAGDAALYRADQRAW
2d4hA           GDVNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDESADFVSFFPDFVWTL
2a2zB           FQTYACLSRIRAQLASEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELD
3ecpA           GDPRRTARLVNVAAQLAKYSGKSITISSEGSKAAQEAYRFIRNPNVSAEAIRKAGAMQTVKLAQE----F
3d3qB           PPDASFSAYEFKKRAEKYIKITRRGKVPIIAGGTGLYIQSLLYNYAFEDKKQVKLKLKELELNNNKLHEY
2dr3F           KGMFAMVDAFTAG-----------------------IGKSKEYEKYIVHDLTDIREFIEVLRQAIRDINA
3bm2B           NRRSASRLAEPA---PTGEQLQNILRAGRAPDWHFFVIEERFSAVLEQGAIAAGSDDKAIDKARNAPFRA
2bbtB           YDEYRYRSVIKACQLEEDISK------------------FAEKDNIVLGITLSGGQRARISLARAVYKDA
3cr7D           NIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETKGLYKKAREGVIKEFT-GISAPYEAP
2dr3B           KG----------------------------MFAMVDAFTAGIGEKYIVHDLTDIREFIEVLRQAIRDINA
1cs4C           ANPENQFRVDYIL---------------------------------------------------------
2bhvD           VIAQVESDIFAHM-------------------GKAVLIPKGSKVIGYYSNNNKMGYRLDIVWSRIITPHG
2bnlC           ----------------------------------------------------------------------
3dm5B           GNPQEKDAIKLAKE----------------------GVDYFKSKGVDIIIVDTAGRHKEDKALIEMKQIS
1ek0A           ERFASLAPYYRNAQAALVKPQSFIKARHWVKELHEQASKDIIIALVGNKIDLQEGGERKVAREEGEKLAE
3dfnC           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
1cjtC           ENQFRVDYILSVMN--------------------------------------------------------
2cckB           FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
3bgwD           AGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMID
3ch4B           MIRWGEEKRIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFPGVDDAESECGLDNFGDF
1dhiA           ---ALAVDRVIGMEN----AMPWN--LPAS---------LAWFKRNTLDKPVIMGRHTWESIGRPLPGRK
3b9qA           VAEKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEE-----------LIACKKAVGKIVSGAP
3cmtD           QPDTGEQALEICDALARSGAVAEMGLAARMMSQAMRKLAGNLKQLLIFINQIRMKNPETTTGGNALKFYA
3a00A           SMIKNNEFIEWAQ---------------FSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELN
2c0bL           VIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPD-FSSKIKLYTGEIPLFSHYQIESQIESAFQR
2dr3C           KGMF--------------------------AMVDAFTAGIGEYEKYIVHDLTDIREFIEVLRQAIRDINA
1e2iA           MGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGT
1dekA           EGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDNFVAFNKITDVINNIEDQWSVRRLMQA
3be4A           EIVLGLEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVIYFEIDSGRCTHPASGRIYHVKY
1e9sE           KGWSFFNEIRNDYDW---------QRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELF
3dauA           ---ALAVDRVIGMENAMPWNLPADLAWFKR-----------NTLNKP----VIMGRHTWESIGRPLPGRK
3cr7B           IAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYPVEVAEQRDPKGLYKKAREGVIKE
3b55A           ---------------------------------------LEAHAKPLKTTNPTASLNDLKPL--KNVGSA
2bwjA           PSGIVLELLKEA---MVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSR
2bnlA           ----------------------------------------------------------------------
3d1mB           ------------------------TPLAYK-QFIPNVAEKTLGASGR----YEGKITRNSERFKELTPNP
3cr7A           RRIAEVAKLFADSNSIAIRQLHEVTGLPEVYVDVVEVAEQRD-PKGLYKKAREGVIKEFTGISAPEAPAN
5dfrA           --------------------MISLIAALAVDRVIGPWNLLAWFKRNTLDKPVIMGRHTWESIGRPLPGRK
2awoA           H------LSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEP
3dfqA           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
3cd9A           LSKDPNEKRDH-----------------------------------------------------------
1e9sB           KGWS-FFNEIRNDYDW-----QRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWT
3bb1C           EGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPP
2a1fF           ----------------------------------------------------SQPIYKRILLKL-----S
3d1mA           ---------------------------------KQFIPNVAEKTLGASG-RYEGKITRNSERFKELNYNP
2b8wB           TEGLGDVEKGDNQNDSW------IFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSVSFF
3cmvB           QPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEISHMGLAARMKLAGNLKQSNTLLIFINQG
1e9sL           KGWSFFNEIRWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRG
2bkeA           DIDNVNNIYYI----------------------RAINTDHQIAIVDDLQELVSKDPSIKLIVVDSVTSHF
2d2eA           PVVPG-VTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGEKKRNEILQLLVLEP
2cvfA           RFILFTPSDFKEDSNFALVVVDSITAHYRAEENRSGLIAELS--RQLQVLLWIARKHNIPVIVINQVHFD
3bo6B           GLLFSVDSPIDKWKVTDMERVDQ--QSRVAVGAQFTLYVKPDQENSQYSASSLHNTRQFIECLESRLSES
1e9rF           KGWSFFNEIR------NDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWT
1cr1A           --------------RQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGC
2bv7A           FIQVFLQSICDGER----------------DENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAP
1cr2A           SDSLKREIIEN-----------------GKFDQWFDELFGNDTFHLYDSFEAETDRLLAKLAYMRSGLGC
3d31A           FPHMNVKKNLEFGMRMK-------KIKDPKRVLDTARDLKIEHLLDRNPLTLSGGEQQRVALARALVTNP
1akeA           TDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVL----EFDVPDELIVDRIVGRRV
3dfpC           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
3cioD           AKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDDLVIVDTPPMLAVSDAAVVGRSV
3dfnA           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
2bhvA           VIAQVESDIFA-------------------HMGKAVLIPKGSKVIGYYSNNNKMGEYRDIVWSRIITPHG
2dflA           LDIDNVMNNI--------------------YYIRAINTDHQIAIVDDLQELVSKDPSIKLIVVDSVTSHF
1e4vA           TDELVIALVKERIAQED-----CRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRR
1d6jA           NIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVA-----------TPGEETGLPFVEVYVDVP
2c7cH           ----------------------------VEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP
1adoA           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
1cfrA           IEFFLESETNFIVVKMPNATSFDVMSIYKSCLSEF-IYDLRSKLSLNNVNLITSNPDFSIIDIRGRREEL
2d2fA           PGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGFSGGEKKRNEILQLLVLEP
1bglA           -----------------------------------------------NDIGVSEATRIDPNAWVERWKAA
1aldA           ---------------------------------------------------TPEQKKELSDIAHRIVAPG
1b0uA           RTRLHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEP
1cjaA           TVVPISKIIPLDASHPHGERVRELLRTLIAHPGHESS----QFHSIRDIITLYTGYDVGTE--GSISMQE
1ckvA           LVDVSSTIGRAYTLG---NKFTITSELMGLDRKLED----------------------------------
3dfnD           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
4atjA           RTEDAFGNANSA---RGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGPSWRVPLGRRDSLQA
3dlbB           CEMSLEAWLAQGHPLPKRVRNAYDRRLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGRVAWVADPK
1d6jB           NIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHETPGEETGLPFVEVYVDVPVEVAEQRAPYEAP
1dyhA           SLIALAVDRVIGMENAMPWNLPADLAWFKR-----------NTLDKP----VIMGRHTWESIGRPLPGRK
1afrA           TRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQERATFISHGN
3dfpD           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
2drcA           ---ALAVDRVIGMEN----AMPFN--LPAD---------LAWFKRNTLDKPVIMGRHTWESIGRPLPGRK
3a00B           SMIKNNEFIEWAQ---------------FSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELN
3dfoD           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
3c85A           AQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYKGQIAAIAEYPD-QL
2d3wA           NQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEP
1e2iB           Y------TTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAP----HIGGEAHAPPPALTLIFDR
1e9rG           KGWSFFNEIRNDYDW--QRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIAT
6aldA           ---------------------------------------------------TPEQKKELSDIAHRIVAPG
3dftD           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
2aumB           PIDGRVALIAPASAIAT-----EVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLEDLHNAFDMP
1draA           ---ALAVDRVIGMEN----AMPWN--LPAE---------LAWFKRNTLDKPVIMGRHTWESIGRPLPGRK
2e85A           ---SAVTDVLLCVGNSMMG------DDGAGPLLAEKCAAAPKGNWVV----IDGGSAPENDIVAIRELRP
3dfqD           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
3dfoC           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
3dftC           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
3czjA           -----------------------------KKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAA
2ccjA           EAMLFAASRREHLVL------------KVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFA
2aunB           ----IDGRVALIAP----ASAIATEVLEATLREVHGVDYHLGRHVEARYRYLAGTVEQRLEDLHNAFDMP
3c15C           LANPENQFRVDYI---------------------------------------------------------
3cueF           TITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFAD
1e9sH           KGWSFFNEIRN-----------------------------------------------------------
2czvB           VIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERANLLRFMMKAWKLVEKYKV
3dymA           --------------------------------KQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWRWKAA
1cr0A           HNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEA--------ETDRLLAKLAYMRSGLGC
1e2jA           AVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPLCYPAARYLMGSMTPQAVLAFVALI
4dfrA           ---ALAVDRVIGMENAMPWNLPADLAWFKR-----------NTLDKP----VIMGRHTWESIGRPLPGRK
1e9sM           KGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET------AKKLALIGTPSMRELFHWT
2dr3D           KGMFAMVDAFTAGIGKS---------------------KEYEKYIVHDLTDIREFIEVLRQAIRDINAKR
3bk7A           YEGTVYELLSKIDS---------SKLNSNFYKTELLKPLGIIDLYDRNVEDLSGGELQRVAIAATLLRDA
3dhwC           FNLLSSRTVFGNVAL-PLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNP
1e2lA           AVVMTSAQITMGMPYAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALI
2bjbA           --------VAVDGTGLPFRV--------RGNGSLAGGTVAIDASASSQFVSSFTDGLTVQHTGSSLPSAP
3crmA           IDIDPAESYSAAEFRAALAAMAKAT--ARGRIPLLVGGTMLY-------YKALLEGLPYTVAQLAIAPEQ
3cmwC           QPDTGEQALEICDALARSGA-VDVIVVDSVAALTPKAEIEGEIGDSH----MGLAARMMSQAMRKLAGNL
2boeX           ------DSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWHNPGQITGQVDALMSAAQAAGKIP
3cnlA           VERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLK----------KGGVPDIERALMLFFTEA
1eamA           EEYLRSIKKQLHP---SKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYI
2b8tD           ILNYIMSNSFNDETKVIGIDEVQFFDDRINILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLT
3bb1G           EGGYINDMALNIIKSFLLDKTIDVLLYVDRLDARVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPP
3dfqC           --------------------------------------------------LTPEQKKELSDIAHRIVAPG
1av6A           EEYLRSIKKQLHPSK-----IILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDF
1e2mB           AVVMTSAQITMGMPYAVTDA-VLAPHIGGEAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF
2dpyB           IAVSPLLRMQGAAYATRIAEDFRDRG-QHVLLIMDSLTR--YAMAQREIALAIGEPPATKGYPPSVFAKL
1drbA           ------------SLIAALAVDRVIGMENAMPWNLPAC--LAWFKRNTLDKPVIMGRHTWESIGRPLPGRK
2anbA           EMISRDAFLEHAEVFGN-------YYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPP
1d2zD           ALISL-----------------------------------------------------------------
1e9rE           KGWSFFNEIRN-------------------------DYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
2a1fD           ----------------------------------------------------------QPIYKRILLKLS
2d7vB           ---SVETEVVTE----------------------------------------------------------
1ckeA           VPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADG
2ancF           ILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSR
1cjuC           VELANPENQFR-----------------------------------------------------------
1e9rD           KGWSF-------------------------FNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
2dftA           EDVVRAALADHDGVLSLGGGAVTSPAALAGHTVVYLEISAAEGVRRTGGNDRAEKYRALMAKRAPLYRRV
2bbtA           YDEYRYRSVIK-----------------ACQLEEDISKFAEKDNIVLGGITLSGGQRARISLARAVYKDA
1e9sI           KGWSFFNEIRNDYDW------------QRYALSVVPRGKTD-------------EAEEWASYGRLLLRET
3cm0A           VPDLILELIRLAERVIFDGFPRTLAQAEALDRSETGT-----RLLGVVLVEVPEEELVRRILRRAE-LEG
2awnA           ----------------------------------------------------------------------
1dekB           NDYPLTRKEFEG---------IDYDRETNLNLTKLEVITIMEQAFCY----LNGKSPIKGVF-VFDDEGK
2cdnA           PSDLTNELVDDRLNNPD----AANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLK
1d8jA           LSGSSGYKFGV------LAKIVNY--MKTRHQRGDTHPLTLDEI-LDETQHLDIGLKQKQWLTEALVNNP
1e2kB           AVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIFDRIAALLCYPAARYLMGSMTPQAVLAFVA
2a1fE           ----------------------------------------------------------QPIYKRILLKLS
3bv4A           ---------------------------------------------------TPEQKKELSDIAHRIVAPG
2dpyA           IAAPADVSP-------------------------------------------------------------
2e85B           ---------------------------------------------------IDGGSAPENDIVAIRELRP
3c14C           VELANPENQFRVDYI-------------------------------------------------------
2ancD           EMISRDAFLEHAEVFGN-------YYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPP
2b0lC           ----------------------------------------------------------------HHMSKA
2d7vA           ---SVETEVVTE----------------------------------------------------------
3dyoA           ---------------------------------------QFTRAPLDNDIGVSEATRIDPNAWVERWKAA
2a1fC           ----------------------------------------------------SQPIYKRILLKL-----S
2an9A           EMISRDAFLEHAEVFGN-------YYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPP
3cmuA           QPDTGEQALEI---------CDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKL
2dftC           EDVVRAALADHDGVLSLGGGAVTSVRAALAGHTVVYLEISAAEGVRRTGGDRAEKYRALMAKRAPLYRRV
3bwdD           LAFSLISKASYENVSKKWIPELKHYA----PGVPIVLVGTKLDLRDDKQFFIDHAVPITTVQGEELKKLI
2bhvC           VIAQVESDIFAH-------------------MGKAVLIPKGSKVIGYYSNNNKGEYRLDIVWSRIITPHG
1e2nB           AVVMTSAQITMGMPYAVTDAVLAP-HIGGEAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF
1bccF           MRDTIYENDDVKEAIRRLPE--------NLYDDRMFRIKRALDLNMRQQILPKEQWTKYEEDVPYLEPYL
3e8aC           V---------------------------------------------------------------------
1e2nA           GEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPP---ALTLIFDRHPIAALLCYPAARYLMG
2ancB           EMISRDAFLEHAEVFGN-------YYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPP
3cnnA           LLLVGSLPVERIEDQRIFERAFEIFARSIGIES--SFSEFFEDFARKRGLLKKGGVPDIERALMLFFTEA
3dfdA           KRVSVGGEYAN---------WLNKAIEINGF---------------------------------------
1c9kC           TADLAPDDAILLE--------------CITTMVTNLLFALGDPEQWDYAAMERAIDDEIQILIAACQRCP
3c7kA           ----------------------------------------------------------------------
1e9rB           KGWSFFNEIR------------------------------------------------------------
1e2hA           AGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQA
2b0lB           -----------------------------------------------------------------HMSKA
2c9gA           ----------------------------------------------------------------------
3bjqB           --------------------------------------------------------QARVV---------
1e2jB           QGESAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSM
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1cjvC           VELANPENQF------------------------------------------------------------
3bs4A           NRLAIVDTFSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKKVW---MDLNLFEGRELYGFAISMSGYL
1e2mA           AVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPP
1dp0A           ------------------------------------LRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAA
2awoD           LRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSP
3cphA           ERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTHANDEAQLLLVGNKSDMETRVVTADQGEALAK
2c95B           KGQLVPLETVLDMLRDAMVAKVNTSKLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGE
1delA           PCLTRKEIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIE
1azsC           VELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGV---------------------------
2d4uB           GSGTVAELMESASISLKQAEKNDYEALPRDPRQSTAAAAEIKRNYDI----YHNALAELIQLLGAGKINE
2ax4A           NIRRIAEVAKAGLVCITSENARKIHESAGLPFFEIFVDAPLNICEGLYKRARAGEIKGFTGIDSDYKPET
3dkvA           PDEVTIGIVRERLSK----SDCERGFLLDGFPRTVAQAEALEEILEEMGRPI--DYVINIQVDKEELMER
2ax4B           ADAGLVCITSFISPFAKDENARKIHESAGLPFFEIFVDAPLNICEGLYKRARAGEIKGFTGIDSDYPETP
3dsrB           ERAVVF----LNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLV-------------------------
2a5vA           RVDFEQRHVHETVAILMARSSAISERIAGGSLAIVGVTYQLDDRAVLRDHIGNIG---------------
1dw9A           DPTYRFYELQVYGTTLKA----------------------------------------------------
2c5mD           --------------------------------------------------------KSCGLHVTSIKIDP
2bwjB           ----------------------------------------------------------------------
1e9sA           KG----WSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTI
2cbzA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3brwA           YPV-------------------LYPKASRLIVTFDEHVISNNFKFGVIYQ----KLGATSEEEL-FSTNE
2bboA           ----------------------------------------------------------------------
1e2lB           LDQGEISAGDAAVV--------MTSAQITMGMPYAVTDAVLAPHIEAGSPPALTLIFDRHPIAALLC-YP
1chdA           --------------------------------------------------------------------SE
2bwjF           ----------------------------------------------------------------------
3b85B           LRDVEPEVIPKLEA--------------GIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQKFLTRLGFGS
2aexA           --------------------------------------------------------------------ED
3cqcA           ----------------------------------------------------------------------
2a5vB           RVDFEQRHVHETVAILMARSSAISERIAGGSLAIVGVTYQLDD---------------------------
2c9oB           ----------------------------------------------------------------------
3e70C           KHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSET------------------NRNLMDEMKKIARVT
3cbqA           GDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLSLEEGRHLAG
1delB           RKEFEGIDY-------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2bwjC           LVPSG---IVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQM
3dvlD           EGKLFILDASPDPEGQEVVGGFDLSALIERINYAI----------------------QKYRARRVSIDSV
2dwqB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLILVLQNGQIIERGRHEDLLALD
3b60A           PILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQADEIVVVEDGIIVERGTHSELLAQH
3b5jA           KILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSPE
3eiuA           DITHPIPDLSGYITEGQIVVARELHRKG---IYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY
2c61B           DITHPIPDLSGYITEGQIVVAREL---HRKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY
3dmdC           RVTKPNLVIFVGDALAGNAIVEQARQFNEKIDGIILTKLDADARGAALSISYVIDAPILFVGVGQGYDLR
2dwoA           DFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIK
2dwpA           DFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIK
3cmvH           LLIFINQGGNALKFYASVRLDIRRIGAVKGENVVGSETRVKAPFKQAEFQILYGEGINFYGELVDLGVKE
2akaB           NCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDGTDARDVLENKLLPLRRGYIGVVNRS
2d3wB           ELCILDESDSLDIDALK-VVADGVNSLRDGKRSFITHYRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLE
3cmvG           LLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGEL
2c03B           EVLGPDEVLLVLDAMTGQEALSVARAFDEGVTGLVLTKLDGARGGAALSARHVTGKPIYFAGVSEKPGLE
2b8tA           AICNECGAEATHSLRKID------GKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIK--
3dtbB           RFCTPASQCPIIDPAWESPEGVPIEGIIFGVPLVYEALSWQHGVFVGAAMRSEAKVIMHDPFAMRPFFNF
2c03A           EVLGPDEVLLVLDAMTGQEALSVARAVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
1dkiA           VHQINRGDFSK------QDWEAQIDKELSQNQPVYYQGVGKVGGHA----FVIDGADGRNFYHVNWGWGD
3dt2A           RFCTPASQCPIIDPAWESPEGVPIEGRPAGVPLVYEALSWQHGVFEATAAAEHKGKVIMHDPFAMRPFFG
3eiuB           DITHPIPDLSGYITEGQIVVARE---LHRKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY
1d1cA           SFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDK
2cjwB           AVQHNV------------------KELFEGIVRQVRLRRDSKEKNERRLAYQKRKE--------------
3b2qA           PGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPLSMPGDDITHPIPDLSGYITEGQIVVARELHRKGI
1e69A           PFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLHGVTMVNGVSAIVPVEV----
1e9cA           LVLFLQLQLADAAKRGAFGHERY--ENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSE
1bifA           GYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDEATEDFMRRIECYENSYESLDEEQDRDLSYIKIMD
3dt4A           RFCTPASQCPIIDPAWESPEGVPIEGRPAGVPLVYEALSWQHGVFEATAAAEHKGKVIMHDPFAMRPFFG
3dmdB           RVTKPNLVIFVGDALAGNAIVEQARQFNEKIDGIILTKLDAARGGAALSISYVIDAPILFVGVGQGYDLR
3c95A           E--FLQGYADELQMLVQKEKVALLKALWQYADEIV-----------------------------------
1e98A           LVLFLQLQLADAAKRGAFGHERYEN--GAFQERALRCFHQLMKDTTLNWKMVDASKRIEAVHEEIRVLSE
2ccgA           INGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQDLKFHEKVIGYQEIIHNESQRFKSVNADQPLENVV
3cmvC           IFINQGGNALKFYASVRLDIRRIGAVKEGENVVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKE
2c04A           EVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
3dm5A           NVIHPHEVILVIDGTIGQQAYNQALAEATPIGSIIVTKLDGSAKGGALSAVAATGAPIKFIGTGEKIDIE
3cmvA           LLIFINQGGNALKFYASVRLDIRRIGVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGEL
2ccjB           INGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKEKVIEGYQEIIQRFKSVNADQPLENV-VEDTYQTI
2ccgB           INGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLVIEGYQEIIHNESQRFKSVNADQPLENV-VEDTYQT-
1e9fA           LVLFLQLQLADAAKRYENGFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELW---
2c9yA           HPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDA-S
1accA           HREVINSSTEGLLLNIDKDI----RKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKY
1e2dA           LVLFLQLQLADAAKRGAFGHERYEN--GAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSE
4dcgA           RLLSIYTGENMRLTRVTKSDAVNYEKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTT
3cddF           LIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTGWRIPQTGKLWNINTL-VPVIDEIGLDEELIADA
2c61A           RGYPGYMYTDLATLYERAGIVKGAKGVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRKGIYPP
3dt7A           RFCTPASQCPIIDPAWESPEGVPIEGRPAGVPLVYEALSWQHGVFEATAAAEHKGKVIMHDPFAMRPFFG
3b2qB           DITHPIPDLSGYITEGQIVVARELHRKGI---YPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY
2ahvA           KEYLYYKAIAPFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMMQVQKMVKKATLHPKSVRIP
2dr3A           KRVVVDSVTTLYINKPAMARSIILQLKGTGCTSIFVSQVSGVEHGVDGIIRLDLDEIDGELKRSLIVW--
1e9dA           LVLFLQLQLADAAKRG---AFGHERYENGAFQERALRCFHQLMKTTLNWKMVDASKSIEAVHEDIRVLSE
2a5gA           DRNWYVQPSCATSGDGLYEGLTWLTS--------------------------------------------
2bofX           PAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQAR------------IYFDAGHSAWHSPA
2ctsA           FARAYAEGIHRTKYWELIYEDCMDLIAKLPCVAAKIYR--------------------------------
2bifA           GYKTFFVESICVDPEVIAANIVQVKLSPDYVNRDSDEATEDFMRR----IECYENSYESLDEEQDRDLSY
3bb1A           DGLPYDEFFSKRSEALLQVVRSGASLKSDIPVVLIENSGRCNKNDSDEK-VLPNGIAWIPHLVQTIT---
2bbsA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMAKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLR
3czpB           RYKITEEDWRNRDKWDQYDAVGDVDRTSTEIAPLVEANDK----RFARVKVLR--TINDAIEAAYK----
2c4rL           GGSIVIDSTEALTAIDINSARGDIEETAFNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVENRE
2czvA           RRFLTSSAQEKWDVRYPRDLISLGVV--IGMEIPQAKASISMY--PEIIL--------------------
3bgwA           VIVMIDYLQLLEPAKANDSRTNQISQIELDVVVIALSQLSRVEQRQDKRPMLSDLGQLEQDADIIEFLYR
3dt4C           RFCTPASQCPIIDPAWESPIEGIIFGGRRPVPLVYEALSWQHGVFEATAAAEHKGKVIMHDPFAMRPFFG
1e4yA           YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQM
2a2zD           GIIYLQATPETCLHRIQGIPLEYLEKLHYKSWLLHRTLKTFDYLQEVPILTLDVNEDFK-DKYESLVEK-
1e1qB           RAAKMNDAFGG----GSLTALPVIETQAGDVSAYIPTNV---ISITDGQIFL-ETELFYKGIRPAINVGL
2b8wA           QPLTPDEYLTYSLKLKKGTSQKDETFNLPRIRKFFPKKKCFFDRPVHRRKLAQLEKLQDEELDPEFVQQV
3da4A           ----------------------------------------------------------------------
2axpA           GLHTYSWDTGQWSSDEIAKDIIFL----------------------------------------------
2ck3C           ALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLERAAKMNDAFGGGSLTALPVIETQAGDV
2dr3E           TSIFVSQVSVGPGVEHGVDGIIRLDLDELKRSLIVWKMRGTSHSMRRHPFDITDKGIIV---YPDKVLKR
3ec1A           R-TKLEKADSLYANQLGELLSPPSKR-YAAEFPPLVPRSLSVKERKTDIVFSGLGWVTCNDPGAQLVVHA
2cgtH           FILLADKKISNIREMLPVLEAVAKAGPLLIIAEDVEGEALATLVVMRGIVKVAAVKAPGFGDRRKAMLQD
1e2fA           LVLFLQLQLADAAKRGAFGHERYENGAFQ-ERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLATE
3a1wA           HLGIPVVFTSSVTGEGLEELKEKIVE--------------------------------------------
2ahwD           KEYLYYKAIAP-DIAFIRATTCDSEGYATFEDEVMYLD--------------------------------
3cddC           GVLLTSDTFGNLVITRASKTKAGVSL-ILGDNVKAARGRFSWRQRFSKFTIKADSAGLPTVGGIKADVTD
1cr4A           DVIILDHISIRKMIDNLMTKLKGFAK-STGVVLVVICHLKDLRQLSDTIIALERNQLVLVRILKCRFT--
2akaA           FNYLNQSGCVDIKGVS-DSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDK
2cckA           NEFAINGLYPDLTIYLNVSAEVGRERRLDQEDLKFHEKVIEGYQEIRFKSVNADQPLEN-----------
2awnB           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP
1e3mA           YSLVLDEIGRGTSTYDGLSLAWACAENKIKALTLFATHYFETQLPEKEGVANVHLDALEHGDTIAFHSQD
1dg3A           QPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHELDPEFVQQVADFCSYIFSN
2bkhA           RYLNRGCTRYFANKETDKQILQNRKSPEYLKKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVL
1e9sG           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAES--------------------------------
3d7wA           LIQMISEAARFNPILWRA-----RQYINSGASFLPDVYMLELETSSTQVQHSTDGVFVTLTNIRDVIASL
1e0jA           ISIVVSASGESDERKMIDNLMTKLKGFAKSVVLVVICHLKNPDKGSDTIIALERNQQGDMPNLVLVRILK
2c9oC           APIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINSEEALNHL
3czpA           RYKITEEDWRNRDKWDQYDAVGDVDRTKRFARVKVLRTINDAIEAAYK----------------------
2a2zA           NNQFGQSLELDGIIYLQATPETCLHRIYLRGRNGIPLEYLEKLHYKHESWLLHRTTNFDYLQEVPILTLD
2aumA           DITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFAD----ISVLLSAFHRHGLPAIHGPVATGLG--
2a30D           GIIYLQATPETCLHRIQGIPLEYLEKLHYKSWLLHRTLKTNFDYLEVPILTLDVNEYES-----------
3bb1H           ---VALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDSDIPVVLIENSGRCNKNDSDEKVLPNG
3bb1B           DGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDELPNGIAWIPHLVQTITEVALNKSES
3cr7C           ANPEVHVKNYELPVQDA---VKQIIDYLDTKGYL------------------------------------
1e3mB           YSLVLDEIGRGTSTYDGLSLAWACLANKIKALTLFATHYFELTQLEKEGVANVHLDALEHGDTIAFHSQD
2axzC           DLTIQTVLKNALTISINRNLKEAQYYINQFNISINGYYDLEINYLKQIYQFLYLNAVNIINIFKIIGK--
2b8tB           AICNECGAEATHSLRKI------DGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIK--
2awnD           ADRFVAGFMNFLPVKVTATAIDQVQVELPMPQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILE--
421pA           SYGIPYIETSAKTRQGVEDAFYTLVR--------------------------------------------
3dffA           LAVNDHSPDSDHDLVGE--VADDIRSIIDEFDPTLVVTCAAIGEHPDHEATRDAALFATHEKNVPVRLWE
3b85A           DDVHFSELTSSDVVRHQ--LVGHIVD--------------------------------------------
3ed8A           ----------------------------------------------------------------------
2d0kA           NIILSSQPGTDDRVTWVKSVDEAIAGDVPEIFVIGGGRVYEQFLKAQKLYLTHIDAEVEGDTHFPDYEPD
1bmfC           ALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLERAAKMNDAFGGGSLTALPVIETQAGDV
1e9sF           AKKLALIGTPSMRELFHWTTIALRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
1aroP           ARINDWFEEVKAKRGKRPTAFQFLQEKPEAVAYITIKTTLACLTSDNTTVQAVASAIGRAIEDEARFGRI
2bkiA           FRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKD--------------------------------
2a30A           GIIYLQATPETCLHRIQGIPLEYLEKLHYKSWLLHRTLKTFDYLQEVPILTLDVNEYESVEKVKEFL---
1e2gA           LVLFLQLQLADAAKRGERYENGAF-------QERALRCFHQMKDTTLNWKMVDASKSIEAVHEDIRVLSE
2d4uA           ---FFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAVS----------------------------------
3cbnA           RTLIRADKAAFDLDEN-------LVRDLRKGRELKVEIIVEYEGH-------------------------
2bc9A           HRIRSKSDFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKKDETFNLPRLCIRKFFPKKKCFVFD
3d3kA           PVLSIDPPVHI-DAKWSLALGLPLPLGEHARIYLCDIGIPQQVFEVGINYHSPFGCKF-VIPL-------
2bhjA           QWSNLQVFNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDG--
2ausC           HGGTLDPKVSGVLPVALERATRVVQALLAGKEYVALMHLHGDVPEDKIRAVMKEFEGEIIQRTRKVYYIE
1e9rA           TIATFDDLRGFLEGTLAESLFAGSNE--------------------------------------------
2b92B           EADGQPLTPDEYLTYSLKLKKGTSQK--DETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKL----
1dvrA           HPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDA--
2a5jA           EHGLIFMETSAKTACNVEEAFINTKEIYRKIQQGL-----------------------------------
3adkA           TSGRVDDNEETIKKRLETYYKATEPVEKRGIVRKVNAEGSVDDVFSQVCTHLDT----------------
3c8uA           NYLLFDAPGWRDDVSIRLEVPADLEARLVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPADL----
2bdtA           ESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI-----------------------------------
1e2hB           VALIPPTLPGTNIVLGALPEDRHIDRLAKDLAMLAAIRRVYGLLA-NTVRYLQCGGSWREDWGQLSGPQS
2awnC           SVFLLDEPLSNLDAALRVQMRIEISRRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH--
1dhjA           NIILSSQPGTDDRVTWVKSVDEAIAADVPEIMVIGGGRVYEQFLKAQKLYLTHIDAEVEGDTHFPDYEPD
2bbsB           DLYLLDSPFGYLDVLTEKEIFESCVCLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLR
2aunA           DITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLFHRHGLPAIHGPVATGLGLQERLA--
3bb1E           DGLPYDEFFSKRSEALLQVVRSGASLKKSDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVL
2awoC           SVFLLDEPLSNLDAALRRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP
2d62A           KV-FLDEPLSNLDAKLRVKRAELKKLQRLGVTTIYVTHD--QVEATGDRIAVNKGELQQVGTPDEVYY--
3bh0A           YLQLLEPAKANDSRTNQISQISRDLARELDVVVIALSQLSRQVERQDKRPMLSDLGQLEQDADIIEFLYR
3cmxA           VRLDIRRIGAVKEGENVVGSETRV---KVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKL----
1ai4B           INLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAPMPFDKWYSASGYETTQDGPTGSLNISVGAKILYEAV
3d3qA           HPNNRKRVLRAIEYKTKKLLSSRKKVQNYDTLLIGIESRETYLRINKRVDILGHGLFNEVQHLVEQGFEA
1e3aB           INLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAPMPFDKWYSASGYETTQDGPTGSLNISVGAKILYEAV
3cmvE           IFINQGGNALKFYASVRLDIRRIGAVKEGENSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLG
1ak2A           HPQSGRSYHEEFNPPKEPMKDDEPLIRRSDDNKKALKIRLEAYHTTTPLVEYYSKRHSAIDASQTPDVVF
2b8tC           AICNECGAEATHSLRKI------DGKHADYNDDIVKIGCQEFYSACRHHHKVPNRPYLN-SNSEEFI---
3cddD           GVLLTSDTFGNLVITRASKTKAGVS-LILGDNVKAARGRFSWRQRFSKFTIKDSAGLPTVGGIKA-----
1e6cA           EALYQDVAHYVVDATQPAAIVCELMQ--------------------------------------------
2a30B           GIIYLQATPETCLHREQGIPLEYLEKLHYKSWLLHRTLKTNFDYLEVPILTLDVNEYESVEKVKEFL---
2bnlB           ----------------------------------------------------------------------
3bjdB           QYVFSGSSRAQLQVFLRHQWFRTFRLYRDAADLLVNLTDVDEAAALARYLYGELGEEDEKGSHPRLLAKL
1culC           ----------------------------------------------------------------------
2bx2L           EVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDFIDMTP---
3bczC           EFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFSYYDESQGEIYRSIEHLDKGSIIEQLDPVSFSNYL
1e59A           KELPLTESLALTIDRVIPYWNEILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVY
1e0jB           ISIVVSASGESDERKMIDNLMTKLKGFAKSVVLVVICHLKNPDQLSDTIIALERNQQGDMPNLVLVRILK
2d3wC           ELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLE
2d4hB           GTSVFDRPVHRRKLAQLEKLQDEELDPEVQQVADFCSYIFSTKTLSGGIQVNGPRLESLVLTYVNAIS--
3di4A           GQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEA---SCHPLLVEIFAPAEGLGDWPSPSVNGYD
3bb1F           DGLPYDEFFSKRSEALLQVVRSGASLKKDIPVVLIENSGRCNKNDSDEKVLPNGIAWIP-HLVQTIT---
1e9sJ           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNETSARFVLSDKLPEHVTMPDGD----
1bg0A           DRFLQTANACRYWPTGRGIFHNDAKTFEEDHLRIISMQKGTVYKRLVTAVDNIESKLPFSHDDRFG----
3bb1D           PVVLIENSGRCNDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDKNLI---------------------
2eg5G           TKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAI--------------------------------
2d3wD           ELCILDESDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYPDYVHVLYQGRIVKSGDFTLVKQLE
1e2kA           IAALLCYPAMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL---AKRQRPGERLDLAMLAAIR
1e9sD           AKKLALIGTPSMRELFHWTTIALRGFLEGTLAESFAGSNEASKALTSARFVLSDKLPEHVTMPDG-----
3bpbA           KVLGLKTGLAYLEHNNLLAAGEFVSKEFQDFNIIEIPEEE---SYAANCIWVNERVIMPAGYPRTREKIA
3clvA           DNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNI--------------------------------------
3dm9B           RVTKPNLVIFVGDALAGNAIVEQARQFNEKIDGIILTKLDAARGGAALSISYVIDAPILFVGVDDLRPFE
1eilA           RIAVQPGELDDLAYAGLEVDDAAALERDKLRQAGVAFTRGDEALMQQRKVMGLLCLQDPFGLPLEIYYGP
2d4hA           RDFSLDLEADGQPLTPDEYLTYSLKLKRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQ
2a2zB           GIIYLQATPETCLHREQGIPLEYLEKLHYESWLLHRTLKTNFDYLEVPILTLDVNEDFK-----------
3ecpA           PELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATFRTVGLLHQEWWMRPDDPADADEK
3d3qB           LASFDKESAKDIHPNNRKRVLRAIEYYLKTKLLIGIESRETLYRINKRVDILGHGLFNEVQHLVEQGFAS
2dr3F           KRVVVDSVTTLYINKPAMARSIILQLKRTGCTSIFVSQVSGFGPGVDGIIRLDLDEIDGELKRSLIVWKM
3bm2B           PLIITVVAKVPRWEQESAGCAVAQAAVAQGFGGIWRSGALTESPVVREAFGCREQDKIVGGTPQLVPDPT
2bbtB           DLYLLDSPFGYLDVLTEKEIFESCVCKLMAKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLR
3cr7D           ANPEVHVKNYELPVQDA---VKQIIDYLDTKGYLP-----------------------------------
2dr3B           KRVVVDSVTTLYINKPAMARSIILQLKGTGCTSIFVSQVSVGERGFPGVEHGVDGIIRLDLDEIDGEL--
1cs4C           ----------------------------------------------------------------------
2bhvD           INIMLTNGYNGLVGELIERNFQRYGVTFGDYLLMQVNQILRDKSKIAPIVVIREGSRVFISPNTDIFF--
2bnlC           ----------------------------------------------------------------------
3dm5B           NVIHPHEVILVIDGTIGQQAQALAFKEATPIGSIIVTKLDGSAKGGALSAVAATGAPIKFIGTGEKIDIE
1ek0A           EKGLLFFETSAKTGENVNDVFLGIGEKIPLK---------------------------------------
3dfnC           KGILAANESTGSIAKRLQSIGTENTEERRFYRQLLLTADDRVNPIGGVILFHETLYQKADD---------
1cjtC           ----------------------------------------------------------------------
2cckB           EVGRERIIKNRLDQEDLKFHEKVIEGYQERFKSVNADQPLENVVDTYQTII----KYLEK----------
3bgwD           YLQLLEPAKANDSRTNQISQISRDMARELDVVVIALSQLSRQVEQQDKRPMLSDLGQLEQDADIIEFLYR
3ch4B           DWVIENHGVEQRLEEQLENLIEFIRS--------------------------------------------
1dhiA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVIMVIGGGRVYEQFLKAQKLYLTHIDAEVEGDTHFPDYEPD
3b9qA           NEILLVLDGNTGL---NMLPQAREFNEVVGITGLILTKLDGSARGCVVSVVEELGIPVKFIGVGEAVELQ
3cmtD           SVRLDIRRIGAVKEGENVVGSETRVKVVKNK--IAAPFKQAEFQILYGEGINFYGELVDLGVKEKL----
3a00A           ARFLFIAPPSVTGAHDKVIVNDDLDKAYKELKDFIFAEK-------------------------------
2c0bL           EVRLPSGGSIVIDSTEALTAIDINLEAADEIARQLRLRDLGVIDFIDMTPVRHQRAVENRLREA------
2dr3C           KRVVVDSVTTLYINKPAMARSIILQLKGTGCTSIFVSQVSGVEHGVDGIIRLDLDEIDGELKRSLIVWKM
1e2iA           NIVLGALPEDAKRQRPGERLDLAMLAAIRRVYGLLVRYLQCGGSWREDWGQLSGTGPRPHFRAPELLAPN
1dekA           LGTDLIVNNFDRMYWVKLFALDYLDKFNSG---YDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSND
3be4A           NPPKQPGIDDVTGEPLVWRDDDNAEAVKVDVFHKQTAPLVKFYEDGILKRVNAKLPPKE-----------
1e9sE           HWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSAR--------------------------------
3dauA           NIILSSQPGTDDRVTWVKSVDEAIAGDVPEIMVIGGGRVYEQFLKAQKLYLTHIDAEVEGDTHFPDYEPD
3cr7B           FTGISAPYEAPANPEVHVKN--------YELPVQDAVKQIIDYLDTKGYLP-------------------
3b55A           SIVGLGEATHGAHEVFTKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLTGKGNHLTPVFKTKELDLL
2bwjA           SSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQNAEGTPEDVFLQLCTAIDSIFL-------------
2bnlA           ----------------------------------------------------------------------
3d1mB           DIIFKDEENTGADRLMTQRCKDKLNALQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKY
3cr7A           PEVHVKNYELPVQDAVK-QIIDYL----DTKGYLP-----------------------------------
5dfrA           NIILSSQPGTDDRVTWVKSVDEAIAACGDEIMVIGGGRVYEQFLKAQKLYLTHIDAEVEGDTHFPDYEPD
2awoA           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP
3dfqA           KGILAASESTGSIAKRLQSIGTENTEERRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
3cd9A           ----------------------------------------------------------------------
1e9sB           TIATFDDLRGFLEGTLAESLFAGSNEASKASARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWR
3bb1C           DGLPYDEFFSKRSEALLQVVRSGASLKSDIPVVLIENSGRCNKNDSDEK-VLPNGIAWIPHLVQTITE--
2a1fF           GEALQGEDGLGIDPAILDRMAVEIKELVEGVEVSVVLGGGNLFRGKLAKAGMNRVVGDHMGMLATVMNGL
3d1mA           DIIFKDEENTGADRLMTQRCKDKLNAQWPGVKLRVTEGWDEDGHHSEES-LHYEGRAVDITTSDRDRSKY
2b8wB           PDFVWTLRDFSLDLEADGQPLTPDEYLSLKLKKGSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLA
3cmvB           GNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKE
1e9sL           FLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDMGPALR
2bkeA           RAEYPGRENLAVRQQKLNKHLHQLTRLAEVIAVIITNQVVPGI--RIQLKKSRGNRRIARVVDAPHLPEG
2d2eA           TYAVLDETDSGLDIDALKVVARGVNAMRGPNFGITHYQRILNYIQPDKVHVMMDGRVVATGGPELALELE
2cvfA           SRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVLERHRFRPEGLMAYFRITERG---------------
3bo6B           GLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQSQ----ALREEPFYRL------------------
1e9rF           TIATFDDLRGFLEGTLAESLFAEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFI----
1cr1A           DVIILDHISIRKMIDNLMTKLKGFAK-STGVVLVVICHLKALRQLSDTIIALERNQLVLVRILKCRFT--
2bv7A           YKSDFLKALSKGQNVTEEECLEKVRLFLVYTATIDVIYEMYTRMNAELN---------------------
1cr2A           DVIILDHISIRKMIDNLMTKLKGFAK-STGVVLVVICHLKSGALLSDTIIALERNNLVLVRILKCRFT--
3d31A           KILLLDEPLSALDPRTQENAREMLSVKKNKLTVLHITHDQTARIMADRIAVVMDGKLIQVGKPEEIFEKP
1akeA           HAPSGRVYHVKFNPPKVEGKDDVTGEEYHQMTAPLIGYYSKAEAGNTKYAKVDGTKPVAEVRAD------
3dfpC           KGILAANESTGSIAKRLQSIGTENEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
3cioD           GTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAI-----------------------------------
3dfnA           KGILAANESTGSIAKRLQSIGTENEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKADD---------
2bhvA           INIMLTNAYNGLVGELIERNFQRYGVPGDYLLMQLMRQSGMGISKIAPIVVIREGSRVFISPNTDI----
2dflA           RAEYPGRENLAVRQQKLNKHLHQLTREVYDIAVIITNQVMHTLYHPGIRIQLKKSRGNRRI-ARVVDAPH
1e4vA           VHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADKILG--
1d6jA           VEAPYEAPANPNYELPVQDAVKQIIDYLDTKGYLP-AKK-------------------------------
2c7cH           FILLADKKISNIREMLPVLEAVAKKPLLIIAEDVEGEALATVVNTMRGIVKVAAVKAPGFGDRRKA----
1adoA           KGILAADESTGSIAKRLQSIGTENTENRRFYRQLLLTADDRVNPIGGVILFHETLYQKADDGR-------
1cfrA           KSMLKDISFSNISLSTISEIDNLYKNFIDELEHIKSFLSVKTTFR-------------------------
2d2fA           TYAVLDETDSGLDIDALKVVARGVNAMRGPNFGITHYQRILNYIQPDKVHVMMDGRVVATGGPELALELE
1bglA           GHYQAEAALLQCTADTLADAVLITTAWQHQGKTLFISRKTYRIDGGQMAITVDVEVASDTPHPARIGLNC
1aldA           KGILAADESTGSIAKRLQSIGTENEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
1b0uA           DVLLFDEPTSALDPELVGEVLRIMQQAEEGKTMVVVTHEMGFARHSSHVIFLHQGKIEEEGDPEQVFGNP
1cjaA           GFLATVRECASFDLDAFERELLSWQESISPQAIPFILRML-RIFH-------------------------
1ckvA           ----------------------------------------------------------------------
3dfnD           KGILAANESTGSIAKRLQSIGTENTEERRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
4atjA           FNANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTL
3dlbB           ---DPRKPIPHLTGLLVPVGSLALSLPWERRRTREIASWIGRRLGGTPEAVRAQAYRLSIPKLMG-----
1d6jB           ANPEVHVKNYELPVQDAKQIIDYLDT--------------------------------------------
1dyhA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLKAQKLYLTHIDAEVEGDTHFPDYEPD
1afrA           TARQAKEHGDIKLAQICGTIAA-----DEKRHETAYTKIVEKLFEDPDGTVLAFADMMRKKISMPAHLMY
3dfpD           KGILAANESTGSIAKRLQSIGTETEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
2drcA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIIGGGRVYEQFLKAQKLYLTHIDAEVEGDTHFPDYEPD
3a00B           ARFLFIAPPSGAH--DKVIVNDDLDKAYKELKDFIFAEK-------------------------------
3dfoD           KGILAANESTGSIAKRLQSIGTETEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
3c85A           EGLLESGVDAAFNIYSEAGSRHVCKQLEPQFTSI------------------------------------
2d3wA           ELCILDESDSGLDIDALKVVADGVNSLRDGKRSVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQ--
1e2iB           HPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGT-NIVLGALPEDRHIDRLAKRERLDLAMLAAIR
1e9rG           FDDLRGFLEGTLAESLASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDMGPALR
6aldA           KGILAADESTGSIAKRLQSIGTETEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
3dftD           KGILAASESTGSIAKRLQSIGTETEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
2aumB           DITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSA----FHRHGLPAIHGPVATGLG--
1draA           NIILSSQPGTDDRVTWVKSVDEAIAGDVPEIMVIGGGRVYEFLPKAQKLYLTHIDAEVEGDTHFPDYEPD
2e85A           TRLL---IVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPDQLKEDIGEVIFLGIQPDIVGFYYPMT--
3dfqD           KGILAASESTGSIAKRLQSIGTETEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
3dfoC           KGILAANESTGSIAKRLQSIGTENTEENRRFYRQLTADDRVNPCIGGVILFHETLYQKADDGR-------
3dftC           KGILAASESTGSIAKRLQSIGTETEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
3czjA           GHYQAEAALLQCTADTLADAVLITTAHAWQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLN
2ccjA           INGLYPDLTIYLNVSAEVGRERNSNRLDQEDLKFHEKVIEGYQEIIHRFKSVNADQPLENVVEDTYQTII
2aunB           DITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSD----ISVLLSAFHRHGLPAIHGPV-------
3c15C           ----------------------------------------------------------------------
3cueF           ANKMPFLETSALDSTNVEDAFLTMARQIKESMS-------------------------------------
1e9sH           ----------------------------------------------------------------------
2czvB           RRFLTSSAQEKWDVRYPRDLISLGVVI--GMEIPQAKASIS--MYPEIIL--------------------
3dymA           GHYQAEAALLQCTADTLADAVLITTAHAWQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLN
1cr0A           DVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHLKLRQLSDTIIALERNQLVLVRILKCRF---
1e2jA           PPTLPGTNIVLGALPEDRHLAKRQRPGERLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQLSGP--
4dfrA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLKAQKLYLTHIDAEVEGDTHFPDYEPD
1e9sM           TIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEH-------------------------
2dr3D           VVVDSVTTLYINKPAMARSIILQLKRVLAGCTSIFVSQVSVGERGFPGVEHGVDGIIRLDLDEIDGEL--
3bk7A           DIYLLDEPSAYLDVEQRLAVSRAIRHEKNEKTALVVEHDVLMIDYVSDRLIVFEGEPGRHGRALPPMGMR
3dhwC           KVLLCDEATSALDPATTRSILELLKDRRLGLTILLITHEMDVKRICDCVAVISNGELIEQDTVSEVFSHP
1e2lA           PPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLRRVYGLLANTVRYLQCGGSWREDWGQ------
2bjbA           HIAMTAAMLRQAGVDIDDSTPNRWQVGPVAARRWIEPDLTNAVAFLSAA-VVSGGTVRITGWPRVSV---
3crmA           RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLLPSIRAVGYRQVWDYLDGKLSYAEMTE----------
3cmwC           K----QSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGE-------------
2boeX           ILVVSNAPGRDCGGSAYRSWIDEFAAGLKNAYIIVEPDLISLMSSMQHVQQEVLETMAYAGALKAGSSQA
3cnlA           GRVSFE----------------------------------------------------------------
1eamA           PHGNKMLQPFAPSYSAEM----RLLSIYTGENMRLTRVTKSDAVNAKKMYYLNKIVRNKVVVNFDYP---
2b8tD           AICNECGAEATHSLRKIDGKHAD-----YNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKF--
3bb1G           DGLPYDEFFSKRSEALLQVVRSGAS--LSDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITE--
3dfqC           KGILAASESTGSIAKRLQSIGTENTENRRFYRQLLLTADDRVNPIGGVILFHETLYQKA-----------
1av6A           YIPHGNKMLQPFAPSYSAEMRLLSIYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFL---
1e2mB           VALIPPTLPGTNIVLGALPEDRHIDRLAKDLAMLAAIRRVYGLL-ANTVRYLQCGGSWREDWG-------
2dpyB           PAL-------------------------------------------------------------------
1drbA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLKAQKLYLTHIDAEVEGDTHFPDYEPD
2anbA           SKIELDRRLRGRGQDSEEVIAKRMAHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALI--
1d2zD           ----------------------------------------------------------------------
1e9rE           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDG
2a1fD           GEALQGEDGLGIDPAILDRMAVEIKEVEMGVEVSVVLGGGNLFRGKLAKAGMNRVVGDHMGMLATVM---
2d7vB           ----------------------------------------------------------------------
1ckeA           VVFPDAPVKIFLDASSEERAMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTLSIE-----------
2ancF           QKQRHDALISKLLA--------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1e9rD           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFASKALTSARFVLSDKLPEHVTMPDGDF---
2dftA           ATMRVDTNRRNPGAVVR-HILSRL----------------------------------------------
2bbtA           DLYLLDSPFGYLDVLTEKEIFECVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQN--
1e9sI           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIR
3cm0A           RSDDNEETVRRRLEVYREKTEPLVGYYEARLKRVDGLGTPDEVYRIRAAL--------------------
2awnA           -----------------------LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP
1dekB           ESVNFVAFNKITDVINNIEDQWSVRRLMQALGTVNNFDRMYWVKLFALDYLDKFNSGYDYY---------
2cdnA           GRGRADDTDDVILNRMKRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALG-----------------
1d8jA           KIEVIDGKYAFKPKYNV-----------------------------------------------------
1e2kB           LIPPTL----------------------------------------------------------------
2a1fE           GEALQGEDGLGIDPAILDRMAVEIKEVEMGVEVSVVLGGGNLFRGKLAKAGMNRVVGDHMGMLATVMNGL
3bv4A           KGILAADESTGSIAKRLQSIGTNTEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKADDGR-------
2dpyA           ----------------------------------------------------------------------
2e85B           TRLLIVD---ATDMGLNPGEIRIIDPDDIAEMFMMTTHYLIDQLKEDIGEVIFLGIQPDIVGFYYPM---
3c14C           ----------------------------------------------------------------------
2ancD           SKIELDRRLRGRGQDSEEVIAKRMAQAVAEMYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALI--
2b0lC           VVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIAVIVNALRKLESAGVIESRSLGMKGTYIKVLNNK
2d7vA           ----------------------------------------------------------------------
3dyoA           GHYQAEAALLQCTADTLADAVLITTAWQHQGKTLFISRKTYRIDGGQMAITVDVEVASDTPHPARIGLNC
2a1fC           GEALQGEDGLGIDPAILDRMAVIKELVEMGVEVSVVLGGGNFRGAKLAKAGMNRVVGDHMGMLATVMNGL
2an9A           SKIELDRRLRGRGQDSEEVIAKRMAQAVAEYDYLIVNDDFDTALTLKTIIRAERLRMSRQKQRHDALI--
3cmuA           AGNLKQSN-TLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGEN-----------
2dftC           ATMRVDTNRRNPGAVVR-HILSRL----------------------------------------------
3bwdD           GAPAYIECSSKSQENVKGVFDAAIRVVLQ-----------------------------------------
2bhvC           INIMLTNAYNGLVGELIERNFQRYG---------------------------------------------
1e2nB           VALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWG-------
1bccF           KEVI------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2nA           SMTPQA----------------------------------------------------------------
2ancB           SKIELDRRLRGRGQDSRMAQAVAEMSHYAEYDYLIVNDDFDTALDLKTIIRAERLRMSQKQRHDALIS--
3cnnA           GRVSFE----------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1c9kC           AKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRL-------AAAADEVWLVVSGIGVK-----------
3c7kA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           VL--------------------------------------------------------------------
2b0lB           VVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVNALRKLESAGVIESRSLGMKGTYIKVLN-N
2c9gA           ----------------------------------------------------------------------
3bjqB           DPILSTHARGYRQSTLIGKKLFPVAPVAQYGKILTFGKEAFRLYNTKRIDFGYEGDPYSIVPSALE----
1e2jB           TPQAVLAFVALIPPTLPGTNIVLG-----ALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRYLQCGG
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3bs4A           EVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRRADYVLKTRS---------
1e2mA           TLPGTNIVLGALPEDRHIDRLAK----RQRPGERLDLAMLAAILLANTVRYLQCGGSWR----EDWGQLS
1dp0A           GHYQAEAALLQCTADTLADATTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHP-------
2awoD           KMNFLPVKVTATAIDQVQVELP-----MPNRQQVWLPVESRDVQVANMSLGIRPEHLLPSDIADV-----
3cphA           ELGIPFIESSAKNDDNVNEIFFTLKLIQEKIDSNKLVGVGN-----------------------------
2c95B           TSGRVDDNEETIKKRLETPVIAFYEK--RGIVRKVNAEGSVDSVFSQVCTHLDA----------------
1delA           DQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRP
1azsC           ----------------------------------------------------------------------
2d4uB           ---FFDQPTQGYQDGFEVAYMEQNDRLHDI----------------------------------------
2ax4A           PERVLKTNLSTVSDCVH-QVVELLQE--------------------------------------------
3dkvA           LTGRRICSV-------------------------------------------------------------
2ax4B           ERVLKTNLSTVSDCVHQ--VVELLQE--------------------------------------------
3dsrB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2c5mD           -YINIDAGLTKDNNLTTGKIYQERKGDYLGKTVQVVPHITDIQEWVMRQALEPQVCVIELGGTVGDI---
2bwjB           ----------------------------------------------------------------------
1e9sA           ATFDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGG--------
2cbzA           -----------------------------------VTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARD
2bwjD           ----------------------------------------------------------------------
3brwA           ESPAFVEFLEFLGQKVKLQDFKGFRGGQTGTESVYCNFRNKEIMEGDAQQLQRKRHIGNDIVAVVF----
2bboA           -----------------------------------VTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQ
1e2lB           AARYLMGSMTPQAVLAFVALI--PPTLPGTNIVLGALPEDRHIDR-----------LAKRLDLAMLAAIR
1chdA           KLIAIGASTGGTEAIRH--VLQPLP--LSSPAVIITQHMPPGFTFAERLNKLCQISVKEAEDGERVLP--
2bwjF           ----------------------------------------------------------------------
3b85B           KVVTGDSGLRLVRHILRGVDDVHFSESSDVVRHQLVGHIVDAY---------------------------
2aexA           ELAHRCSSFMAPPVTDLGELRRRPGDMQVCQALAQVDGGANKEGGGGISCVLQDGCVFEKAGVSISVVHG
3cqcA           -------------QMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKL-
2a5vB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3e70C           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDLR
3cbqA           TLSCKHIETSAALHHNFEGAVRQIRLRR------------------------------------------
1delB           ----------------------------------------------------------------------
3dmdA           --------------------------------------------GAALSISYVIDAPILFVGVGQGYDLR
2bwjC           SRSSLPVDDTTKTIAKRLEAYYRASIPVKTQLHKINAEGTPEDVFLQLCTAIDS----------------
3dvlD           TSVFQQYDASSVVRRELFRLVARLKQ--IGATTVMTTERIE-----------------------------
2dwqB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GWYAQTYQSQQLEMKGEEDAE
3b60A           GVYAQLHKMQ-----------
3b5jA           SLYSYLYQLQ-----------
3eiuA           AEGRDLRGLVAIVGKEALSER
2c61B           AEGRDLRGLVAIVGKEALSER
3dmdC           PFEKEWFLER-----------
2dwoA           VIDVGRRFLVNRVQ-------
2dwpA           VIDVGRRFLVN----------
3cmvH           KLIEKAGAWYSYKG-------
2akaB           QKDIDGKKDITAALAAERKFF
2d3wB           EQG------------------
3cmvG           VDLGVKEKLIE----------
2c03B           PFYPERLAGRILGMGD-----
2b8tA           ---------------------
3dtbB           GKYLAHWLSMAHRPAAK----
2c03A           PFYPERLAGRILGM-------
1dkiA           GFFRLDALYQS-AVVGIK---
3dt2A           YNFGK-YLAHWLSMAHRPA--
3eiuB           AEGRDLRGLVAIVGKEALSER
1d1cA           TALNAASTVFGVNP-------
2cjwB           ---------------------
3b2qA           YPPINVLPSLSRLMNSGIGAG
1e69A           ---------------------
1e9cA           DAIATATEKP-----------
1bifA           VGQSYVVNRVADHI-------
3dt4A           YNFGK-YLAHWLSMAHRPAAK
3dmdB           PFEKEWFLERIF---------
3c95A           ---------------------
1e98A           DAIRTATEKP-----------
2ccgA           EDTYQTIIKY-----------
3cmvC           KLIEKAGAWYSYKG-------
2c04A           PFYPERLAGRILGM-------
3dm5A           PFDPPRFVSRLLGL-------
3cmvA           VDLGVKEKLIEKAGAWYSYKG
2ccjB           IKY------------------
2ccgB           ---------------------
1e9fA           ---------------------
2c9yA           QTPDVVFA-------------
1accA           NDKLPLYISN-----------
1e2dA           DAIATATEKP-----------
4dcgA           KLFLQQSIFRFLN--------
3cddF           GRLAVISVVR-----------
2c61A           INVLPSLSRL-----------
3dt7A           YNFGKYLAHW-----------
3b2qB           AEGRDLRGLVAIVGKEALSER
2ahvA           GYLVDIVVVDPDQSQ------
2dr3A           ---------------------
1e9dA           DAIATATEKP-----------
2a5gA           ---------------------
2bofX           QMASWLQQAD-----------
2ctsA           ---------------------
2bifA           IKIMDVGQSYVVNRVADH---
3bb1A           ---------------------
2bbsA           PDFSSKLMSFDQFSAERRNSI
3czpB           ---------------------
2c4rL           AVRQDRARIQISH--------
2czvA           ---------------------
3bgwA           DDYYDKESESKNIVEVI----
3dt4C           YNFGK-YLAHWLSMAHRPAA-
1e4yA           TAPLIGYYSKEAEA-------
2a2zD           ---------------------
1e1qB           SVSRVGSAAQTRAMK------
2b8wA           ADFCSYIFSNSKTKTLSGG--
3da4A           ---------------------
2axpA           ---------------------
2ck3C           SAYIPTNVISITDG-------
2dr3E           G--------------------
3ec1A           PKGVDVFIRQSL---------
2cgtH           IATLTGGTVISEEI-------
1e2fA           KPLGELWK-------------
3a1wA           ---------------------
2ahwD           ---------------------
3cddC           GRYRPLII-------------
1cr4A           ---------------------
2akaA           TALNAASTVFGVNP-------
2cckA           ---------------------
2awnB           ADRFVAGFIGSPKM-------
1e3mA           GAASKSYGLAVAALAGVPK--
1dg3A           SKTKTLSGGIQVN--------
2bkhA           HLGNIDFEEAGCNLKNKST--
1e9sG           ---------------------
3d7wA           A--------------------
1e0jA           CRFT-----------------
2c9oC           GEIGTKTTLRYSV--------
3czpA           ---------------------
2a2zA           V--------------------
2aumA           ---------------------
2a30D           ---------------------
3bb1H           IAWIPHLVQTITEVALNKSES
3bb1B           IFVDKNL--------------
3cr7C           ---------------------
1e3mB           GAASKSY--------------
2axzC           ---------------------
2b8tB           ---------------------
2awnD           ---------------------
421pA           ---------------------
3dffA           DLPYAVFKSGAVEL-------
3b85A           ---------------------
3ed8A           ---------------------
2d0kA           DW-------------------
1bmfC           SAYIPTNVISITDG-------
1e9sF           RSWLEDPN-------------
1aroP           RDLEAKHFKKFMQVVEADMLS
2bkiA           ---------------------
2a30A           ---------------------
1e2gA           DAIATATE-------------
2d4uA           ---------------------
3cbnA           ---------------------
2bc9A           RPVHRRKLAQLEKL-------
3d3kA           ---------------------
2bhjA           ---------------------
2ausC           ILE-IDGRDVLFRV-------
1e9rA           ---------------------
2b92B           ---------------------
1dvrA           ---------------------
2a5jA           ---------------------
3adkA           ---------------------
3c8uA           ---------------------
2bdtA           ---------------------
1e2hB           N--------------------
2awnC           ---------------------
1dhjA           D-WESVSSEF-----------
2bbsB           DSFDQFSAERRNSILTET---
2aunA           ---------------------
3bb1E           NKSESIFVDKNL---------
2awoC           ADRFVAG--------------
2d62A           ---------------------
3bh0A           DDYYDKESESKNIVEVI----
3cmxA           ---------------------
1ai4B           QGDKSPIPQAVDLFAGKPQQE
3d3qA           SQSAIGYKELVPVIKGNISEN
1e3aB           QGDKSPIPQAVDLF-------
3cmvE           VKE------------------
1ak2A           ASILAAFSKA-----------
2b8tC           ---------------------
3cddD           ---------------------
1e6cA           ---------------------
2a30B           ---------------------
2bnlB           ---------------------
3bjdB           LEAIGLEADFQAVSTPEEIA-
1culC           ---------------------
2bx2L           ---------------------
3bczC           KKYHNTICGRHPIGVLLNAIT
1e59A           EFDENFKPLKRYYLGNADEIA
1e0jB           CRFTGDTIAGYMEYNKE----
2d3wC           EQG------------------
2d4hB           ---------------------
3di4A           RSHGR----------------
3bb1F           ---------------------
1e9sJ           ---------------------
1bg0A           ---------------------
3bb1D           ---------------------
2eg5G           ---------------------
2d3wD           EGYGW----------------
1e2kA           RVYGLLANTVRYLQCGGSWRE
1e9sD           ---------------------
3bpbA           RLGYRVIEVDTSE--------
3clvA           ---------------------
3dm9B           ---------------------
1eilA           AEIFHEPFLPSAPV-------
2d4hA           VADFCSYIFSNSKTKTLSG--
2a2zB           ---------------------
3ecpA           ESGKWLAAAATSRL-------
3d3qB           QSQAIGYKELVPVIKGNISEN
2dr3F           RGTSHSMRRHPFDITDK----
3bm2B           PFVTYFH--------------
2bbtB           PDFSSKLMDSFDQFSAERRNS
3cr7D           ---------------------
2dr3B           ---------------------
1cs4C           ---------------------
2bhvD           ---------------------
2bnlC           ---------------------
3dm5B           PFDPPRFVSR---LLGLGD--
1ek0A           ---------------------
3dfnC           ---------------------
1cjtC           ---------------------
2cckB           ---------------------
3bgwD           DDYYDKESESKNIVEVI----
3ch4B           ---------------------
1dhiA           DWFSEFHDADAQN--------
3b9qA           PFDPEAFVNAIF---------
3cmtD           ---------------------
3a00A           ---------------------
2c0bL           ---------------------
2dr3C           RGTSHSMRRHPFDITDKGIIV
1e2iA           GDLYNVFAWA-----------
1dekA           ---------------------
3be4A           ---------------------
1e9sE           ---------------------
3dauA           DW-ESVFSEF-----------
3cr7B           ---------------------
3b55A           DWIRQYNANPK----------
2bwjA           ---------------------
2bnlA           ---------------------
3d1mB           GMLARLAVEAGFDWVYYE---
3cr7A           ---------------------
5dfrA           DWESVFSEFHDADAQNSHSYC
2awoA           ADRFVAGFIGSPKMNFLP---
3dfqA           ---------------------
3cd9A           ---------------------
1e9sB           EDMGPALR-------------
3bb1C           ---------------------
2a1fF           AMRDSLFRADVNAK-------
3d1mA           GMLARLAVEAGFDWVYYE---
2b8wB           QLEKLQDEELDPEFVQQV---
3cmvB           KLIEKAGAWYSYKGEKIGQG-
1e9sL           PLISAWVDVVCTSI-------
2bkeA           EVVFALTEEGIRDAE------
2d2eA           AKGYEWLKEK-----------
2cvfA           ---------------------
3bo6B           ---------------------
1e9rF           ---------------------
1cr1A           ---------------------
2bv7A           ---------------------
1cr2A           ---GDTGIAGYMEYNKE----
3d31A           VEG------------------
1akeA           ---------------------
3dfpC           ---------------------
3cioD           ---------------------
3dfnA           ---------------------
2bhvA           ---------------------
2dflA           LPEGEVV----FALTEERDA-
1e4vA           ---------------------
1d6jA           ---------------------
2c7cH           ---------------------
1adoA           ---------------------
1cfrA           ---------------------
2d2fA           AKG-YEWLKEKVK--------
1bglA           QLAQVAERVNW----------
1aldA           ---------------------
1b0uA           QPRLQQFLKGSLK--------
1cjaA           ---------------------
1ckvA           ---------------------
3dfnD           ---------------------
4atjA           RGL------------------
3dlbB           ---------------------
1d6jB           ---------------------
1dyhA           DWFSEFHDADAQN--------
1afrA           DGR------------------
3dfpD           ---------------------
2drcA           DWESVFSEFHDADAQNSH---
3a00B           ---------------------
3dfoD           ---------------------
3c85A           ---------------------
2d3wA           ---------------------
1e2iB           RVYGLLANTVRYLQCGGSWRE
1e9rG           PLISAWVDVVCTSILSLPEEP
6aldA           ---------------------
3dftD           ---------------------
2aumB           ---------------------
1draA           DW-------------------
2e85A           ---------------------
3dfqD           ---------------------
3dfoC           ---------------------
3dftC           ---------------------
3czjA           CQLAQVAERVNWLGLGPQEN-
2ccjA           KYLEK----------------
2aunB           ---------------------
3c15C           ---------------------
3cueF           ---------------------
1e9sH           ---------------------
2czvB           ---------------------
3dymA           CQLAQVAERVN----------
1cr0A           ---------------------
1e2jA           ---------------------
4dfrA           DWFSEFHDADAQN--------
1e9sM           ---------------------
2dr3D           ---------------------
3bk7A           EGMNRFLASVGITFRRDPDS-
3dhwC           KTP------------------
1e2lA           ---------------------
2bjbA           ---------------------
3crmA           ---------------------
3cmwC           ---------------------
2boeX           RIYFDAGHSAWHS--------
3cnlA           ---------------------
1eamA           ---------------------
2b8tD           ---------------------
3bb1G           ---------------------
3dfqC           ---------------------
1av6A           ---------------------
1e2mB           ---------------------
2dpyB           ---------------------
1drbA           DWESVFSEFHDADAQNSH---
2anbA           ---------------------
1d2zD           ---------------------
1e9rE           DFSIRSWLED-----------
2a1fD           ---------------------
2d7vB           ---------------------
1ckeA           ---------------------
2ancF           ---------------------
1cjuC           ---------------------
1e9rD           ---------------------
2dftA           ---------------------
2bbtA           ---------------------
1e9sI           SWLEDPN--------------
3cm0A           ---------------------
2awnA           ADRFVAGFIGSPKM-------
1dekB           ---------------------
2cdnA           ---------------------
1d8jA           ---------------------
1e2kB           ---------------------
2a1fE           AMRDSLFRADV----------
3bv4A           ---------------------
2dpyA           ---------------------
2e85B           ---------------------
3c14C           ---------------------
2ancD           ---------------------
2b0lC           F-LIELEN-------------
2d7vA           ---------------------
3dyoA           QLAQVAER-------------
2a1fC           AMRDSLFRADVNAK-------
2an9A           ---------------------
3cmuA           ---------------------
2dftC           ---------------------
3bwdD           ---------------------
2bhvC           ---------------------
1e2nB           ---------------------
1bccF           ---------------------
3e8aC           ---------------------
1e2nA           ---------------------
2ancB           ---------------------
3cnnA           ---------------------
3dfdA           ---------------------
1c9kC           ---------------------
3c7kA           ---------------------
1e9rB           ---------------------
1e2hA           ---------------------
2b0lB           KFLIELENLK-----------
2c9gA           ---------------------
3bjqB           ---------------------
1e2jB           SWREDWGQLSGTAVPQSNA--
1d6aA           ---------------------
3do6A           ---------------------
1cjvC           ---------------------
3bs4A           ---------------------
1e2mA           G--------------------
1dp0A           ---------------------
2awoD           ---------------------
3cphA           ---------------------
2c95B           ---------------------
1delA           G--QKSNDTHITEA-------
1azsC           ---------------------
2d4uB           ---------------------
2ax4A           ---------------------
3dkvA           ---------------------
2ax4B           ---------------------
3dsrB           ---------------------
2a5vA           ---------------------
1dw9A           ---------------------
2c5mD           ---------------------
2bwjB           ---------------------
1e9sA           ---------------------
2cbzA           GAFAEFLRTY-----------
2bwjD           ---------------------
3brwA           ---------------------
2bboA           PDFSSKLMSFDQFSAERRNSI
1e2lB           RVYGLLANTVRYLQCGGSWRE
1chdA           ---------------------
2bwjF           ---------------------
3b85B           ---------------------
2aexA           NLSEE----------------
3cqcA           ---------------------
2a5vB           ---------------------
2c9oB           ---------------------
3e70C           PFEKEWFLERIF---------
3cbqA           ---------------------
1delB           ---------------------
3dmdA           PFEKEWFLERIF---------
2bwjC           ---------------------
3dvlD           ---------------------
2dwqB           ---------------------