[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56317.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dy1A.bssp"
#ERROR : Can't open dsspfile "2bm1A.bssp"
#ERROR : Can't open dsspfile "3dpuA.bssp"
#ERROR : Can't open dsspfile "2bm0A.bssp"
#ERROR : Can't open dsspfile "2efgA.bssp"
#ERROR : Can't open dsspfile "2bv3A.bssp"
#ERROR : Can't open dsspfile "1darA.bssp"
#ERROR : Can't open dsspfile "2cnqA.bssp"
#ERROR : Can't open dsspfile "2e1rA.bssp"
#ERROR : Can't open dsspfile "2brvX.bssp"
#ERROR : Can't open dsspfile "2cnuA.bssp"
#ERROR : Can't open dsspfile "2cnvA.bssp"
#ERROR : Can't open dsspfile "1eftA.bssp"
#ERROR : Can't open dsspfile "2cg8C.bssp"
#ERROR : Can't open dsspfile "2b7cA.bssp"
#ERROR : Can't open dsspfile "2c77A.bssp"
#ERROR : Can't open dsspfile "1aipA.bssp"
#ERROR : Can't open dsspfile "2ahoA.bssp"
#ERROR : Can't open dsspfile "1b23P.bssp"
#ERROR : Can't open dsspfile "1d8tA.bssp"
#ERROR : Can't open dsspfile "2bvnA.bssp"
#ERROR : Can't open dsspfile "2d74A.bssp"
#ERROR : Can't open dsspfile "3cw2B.bssp"
#ERROR : Can't open dsspfile "1d8tB.bssp"
#ERROR : Can't open dsspfile "2c78A.bssp"
#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "1egaB.bssp"
#ERROR : Can't open dsspfile "2bvnB.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1aym1.bssp"
#ERROR : Can't open dsspfile "3dnfA.bssp"
#ERROR : Can't open dsspfile "1efcA.bssp"
#ERROR : Can't open dsspfile "1dg1G.bssp"
#ERROR : Can't open dsspfile "2dcuA.bssp"
#ERROR : Can't open dsspfile "1aipE.bssp"
#ERROR : Can't open dsspfile "3ec5A.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "2byeA.bssp"
#ERROR : Can't open dsspfile "1eguA.bssp"
#ERROR : Can't open dsspfile "3a1sA.bssp"
#ERROR : Can't open dsspfile "1a4xB.bssp"
#ERROR : Can't open dsspfile "1egaA.bssp"
#ERROR : Can't open dsspfile "2e87A.bssp"
#ERROR : Can't open dsspfile "3cwqA.bssp"
#ERROR : Can't open dsspfile "1efuA.bssp"
#ERROR : Can't open dsspfile "3bb3A.bssp"
#ERROR : Can't open dsspfile "3batA.bssp"
#ERROR : Can't open dsspfile "3chuB.bssp"
#ERROR : Can't open dsspfile "1c82A.bssp"
#ERROR : Can't open dsspfile "3chuA.bssp"
#ERROR : Can't open dsspfile "2dbyA.bssp"
#ERROR : Can't open dsspfile "3d5bF.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "3e3xA.bssp"
#ERROR : Can't open dsspfile "3bb4A.bssp"
#ERROR : Can't open dsspfile "3dsnC.bssp"
#ERROR : Can't open dsspfile "1d2eA.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "2dwqA.bssp"
#ERROR : Can't open dsspfile "3dpbB.bssp"
#ERROR : Can't open dsspfile "2dykA.bssp"
#ERROR : Can't open dsspfile "1byuB.bssp"
#ERROR : Can't open dsspfile "2cxxB.bssp"
#ERROR : Can't open dsspfile "1aztB.bssp"
#ERROR : Can't open dsspfile "1ecrA.bssp"
#ERROR : Can't open dsspfile "3defA.bssp"
#ERROR : Can't open dsspfile "2ahjD.bssp"
#ERROR : Can't open dsspfile "3ea5C.bssp"
#ERROR : Can't open dsspfile "3a1vA.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "1d1nA.bssp"
#ERROR : Can't open dsspfile "3dsnE.bssp"
#ERROR : Can't open dsspfile "1a2kC.bssp"
#ERROR : Can't open dsspfile "3dosE.bssp"
#ERROR : Can't open dsspfile "3bjqE.bssp"
#ERROR : Can't open dsspfile "3a1sB.bssp"
#ERROR : Can't open dsspfile "2cxxC.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "3ea5A.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2bkuA.bssp"
#ERROR : Can't open dsspfile "2cxxA.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "2atxA.bssp"
#ERROR : Can't open dsspfile "3a1tA.bssp"
#ERROR : Can't open dsspfile "1e5rB.bssp"
#ERROR : Can't open dsspfile "3a1vB.bssp"
#ERROR : Can't open dsspfile "3a1uB.bssp"
#ERROR : Can't open dsspfile "2ahjB.bssp"
#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"

## Summary of PDB Search
:514
    2e-51  24%  2dy1A  [x.x.x] ELONGATION FACTOR G
    1e-33  24%  2bm1A  [x.x.x] ELONGATION FACTOR G
    3e-33   9%  3dpuA  [x.x.x] RAB FAMILY PROTEIN
    4e-32  22%  2bm0A  [x.x.x] ELONGATION FACTOR G
    9e-32  23%  2efgA  [c.37.1 - b.43.3 - d.14.1 - d.58.11] PROTEIN (ELONGATION
    4e-29  24%  2bv3A  [x.x.x] ELONGATION FACTOR G
    1e-28  22%  1darA  [x.x.x] ELONGATION FACTOR G
    6e-28  12%  2cnqA  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE
    1e-27  18%  2e1rA  [x.x.x] ELONGATION FACTOR 2
    5e-25   7%  2brvX  [x.x.x] HYALURONATE LYASE
    4e-22  12%  2cnuA  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE
    2e-21   9%  2cnvA  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE
    4e-21  21%  1eftA  [x.x.x] ELONGATION FACTOR TU
    5e-21  10%  2cg8C  [x.x.x] DIHYDRONEOPTERIN ALDOLASE 6-HYDROXYMETHYL-7,8-
    7e-21  18%  2b7cA  [x.x.x] ELONGATION FACTOR 1-ALPHA
    2e-19  23%  2c77A  [x.x.x] ELONGATION FACTOR TU-B
    4e-19  23%  1aipA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    5e-18  12%  2ahoA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    2e-17  20%  1b23P  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    3e-17  30%  1d8tA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-16  29%  2bvnA  [x.x.x] ELONGATION FACTOR TU
    5e-16  15%  2d74A  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    9e-16  12%  3cw2B  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT GAMMA
    1e-15  27%  1d8tB  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    3e-15  23%  2c78A  [x.x.x] ELONGATION FACTOR TU-A
    4e-15  17%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    5e-15  10%  1egaB  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    5e-15  29%  2bvnB  [x.x.x] ELONGATION FACTOR TU
    1e-14  14%  1eg7A  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    1e-14   8%  1aym1  [b.121.4] HUMAN RHINOVIRUS 16 COAT PROTEIN
    2e-14  15%  3dnfA  [x.x.x] 4-HYDROXY-3-METHYLBUT-2-ENYL DIPHOSPHATE
    3e-14  27%  1efcA  [c.37.1 - b.43.3 - b.44.1] PROTEIN (ELONGATION FACTOR)
    3e-14  27%  1dg1G  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-14  14%  2dcuA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    7e-14  23%  1aipE  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-13  11%  3ec5A  [x.x.x] OUTER SURFACE PROTEIN A
    3e-13  17%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
    6e-13  15%  2byeA  [x.x.x] PHOSPHOLIPASE C, EPSILON 1
    6e-13   7%  1eguA  [a.102.3 - b.30.5 - b.24.1] HYALURONATE LYASE
    1e-12  15%  3a1sA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-12  13%  1a4xB  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    3e-12  10%  1egaA  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    5e-12  13%  2e87A  [x.x.x] HYPOTHETICAL PROTEIN PH1320
    5e-12  11%  3cwqA  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    6e-12  28%  1efuA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    3e-11   6%  3bb3A  [x.x.x] T7I23.11 PROTEIN
    4e-11  16%  3batA  [x.x.x] MYOSIN HEAVY CHAIN, STRIATED MUSCLE/GENERAL
    7e-11   4%  3chuB  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    2e-10   8%  1c82A  [a.102.3 - b.30.5 - b.24.1] HYALURONATE LYASE
    3e-10   6%  3chuA  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    1e-09  14%  2dbyA  [x.x.x] GTP-BINDING PROTEIN
    1e-09  11%  3d5bF  [x.x.x] 50S RIBOSOMAL PROTEIN L4
    4e-09  15%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    6e-09   9%  3e3xA  [x.x.x] BIPA
    7e-09  13%  3bb4A  [x.x.x] T7I23.11 PROTEIN
    9e-09  11%  3dsnC  [x.x.x] F1 CAPSULE ANTIGEN
    1e-08  22%  1d2eA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU (EF-TU)
    5e-08  13%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    6e-08  13%  2dwqA  [x.x.x] GTP-BINDING PROTEIN
    7e-08  14%  3dpbB  [x.x.x] F1 CAPSULE ANTIGEN
    8e-08  16%  2dykA  [x.x.x] GTP-BINDING PROTEIN
    1e-07  12%  1byuB  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    2e-07   9%  2cxxB  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    3e-07  13%  1aztB  [c.37.1 - a.66.1] GS-ALPHA
    3e-07   9%  1ecrA  [e.2.1] PROTEIN (REPLICATION-TERMINATOR PROTEIN)
    5e-07  11%  3defA  [x.x.x] T7I23.11 PROTEIN
    7e-07   5%  2ahjD  [b.34.4] NITRILE HYDRATASE
    7e-07  17%  3ea5C  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    2e-06  17%  3a1vA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-06  12%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-06  12%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    4e-06  17%  1d1nA  [b.43.3] INITIATION FACTOR 2
    4e-06  15%  3dsnE  [x.x.x] F1 CAPSULE ANTIGEN
    6e-06  13%  1a2kC  [c.37.1] RAN
    7e-06  14%  3dosE  [x.x.x] F1 CAPSULE ANTIGEN
    2e-05  10%  3bjqE  [x.x.x] PHAGE-RELATED PROTEIN
    3e-05  19%  3a1sB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-05   8%  2cxxC  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    8e-05   8%  1ahjB  [b.34.4] NITRILE HYDRATASE (SUBUNIT BETA)
    9e-05  12%  3ea5A  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    1e-04  14%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-04  15%  2bkuA  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    1e-04   9%  2cxxA  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    3e-04  15%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    4e-04  11%  2atxA  [x.x.x] SMALL GTP BINDING PROTEIN TC10
    4e-04  21%  3a1tA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    4e-04  10%  1e5rB  [b.82.2] PROLINE OXIDASE
    7e-04  16%  3a1vB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    8e-04  23%  3a1uB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    9e-04   4%  2ahjB  [b.34.4] NITRILE HYDRATASE
    1e-10  25%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA(query 19->181)
    1e-09  25%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA(query 7->181)
:514

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIEKQRGISVTSS
2dy1A           -------AMIRTVALVGHAGSGKTTLTEALLYKTGAKERRGRVEEGTTTT----DYTPEAKLHRTTVRTG
2bm1A           ---EYDLKRLRNIVIAAHIDAGKTTTTERILYYTGRIITAAVT---------------------------
3dpuA           ---GKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMA---GKTSLLKQLIGGLNVVTKQAPNIKGL
2bm0A           ---EYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIATITAAVTTCFWKDHRINIIDAPGHVDFTI
2efgA           -----DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIAAVTTC---------------------------
2bv3A           -----DLKRLRNIGIAAHIDAGKTTTTERIL-----------------------YYTGRIHKRGITITAA
1darA           VKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRAAVTTCF---------------------------
2cnqA           ----------------------------------------------------------------------
2e1rA           --LMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAAKER----GITIKSTAISLYSEMSDEDVKEI
2brvX           ------------------------------------------------------DTYTDRLDDWNGIIAG
2cnuA           ----------------------------------------------------------------------
2cnvA           ----------------------------------------------------------------------
1eftA           --EFIRTKPHVNVGTIGHVDHGKTTLTAALTFVTAAENPNVEVK-----DYGDIDKAPEERARGITINTA
2cg8C           ----------------------------------------------------------------------
2b7cA           -------KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEKYAWVLDKLKAERERGITIDIA
2c77A           --EFIRTKPHVNVGTIGHVDHGKTTLTAALTYVTAAENPNVEVK-----DYGDIDKAPEERARGITINTA
1aipA           -------KPHVNVGTIGHVDHGKTTLTAALTY--------------------------VTAAENPTAHV-
2ahoA           ---WPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSGMTIKLGYAETNGVCESCKKPEAYVTEPSCKSCG
1b23P           --EFIRTKPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEVK-----DYGDIDKAPEERARGITINTA
1d8tA           --KFERTKPHVNVGTIGHVDHGKTTLTAAIT----------TVLAKTYGGAARADNAPEEKARGITINTS
2bvnA           -------KPHVNVGTIGHVDHGKTTLTAAI-----------------TTVLAKT--YGGEKARGITINTS
2d74A           -------QAEVNIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIGFADAEIRRCSNCGRYSTSPICPY
3cw2B           ----PKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSTIKLGYAETNIG-VCESCKKPEAYVTEPSCKSCG
1d8tB           -------KPHVNVGTIGHVDHGKTTLTAAITTVLAKTY------GGAARAFDQIDNAPEEKARGITINTS
2c78A           -------KPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEVK-----DYGDIDKAPEERARGITINTA
3cb4D           ----------------------------------------------------------------------
1egaB           -----DKSYCGFIAIVGRPNVGKSTLLNKLLGQKISITS-------------RKAQTTRHRIVGIHTEGA
2bvnB           ----ERTKPHVNVGTIGHVDHGKTTLTAAI-----------------TTVLAKT-----YGARGITINTS
1eg7A           -----------------------------------------------YVVTEAGFGADLGAEKFYDVKCR
1aym1           --------------------------------------------------------PVERYVDEVLNEVL
3dnfA           ----------------------------------------------------------------------
1efcA           -------KPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGG------AARAFDQIDNAPEEKARGITINTS
1dg1G           -------KPHVNVGTIGHVDHGKTTLTAAITTVLAKTY------GGAARAFDQIDNAPEEKARGITINTS
2dcuA           ----KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTHSEELRRGITIKIGFADRCSNCGRYSTSPICPY
1aipE           -------KPHVNVGTIGHVDHGKTTLTAALTYVTAAENPAH-----------------------------
3ec5A           ---TYELFNEKGELSEKKITRADKSSTYELFNEKGELSLKYITRADGTRL----EYTGIKSDGSGKAKEV
3degC           ----------------------------------------------------------------------
2byeA           ----------------------------------------------------------------------
1eguA           ------------------------------------------------------DTYTDRLDDWNGIIAG
3a1sA           ---------HVKVALAGCPNVGKTSLFNALTG----------------------TKQYVANWPGVTVEKK
1a4xB           --MIERNKGMN-NCILVGIKTRGIYLAKRLAERIEQIEGN----------PVTVGEIDITLYDEPLVKGA
1egaA           -----DKSYCGFIAIVGRPNVGKSTLLNKLLG-------------QKISITSRKAQTTRHRIVGIHTEGA
2e87A           KDLPVVDLEIPTVVIAGHPNVGKSTLLKALTTAKPEIAS--------YPFTTRGINVGQFEDGYFRYQII
3cwqA           -------------TVASKGGVGKTTTAVHLSAYLALQGETLLIDGDPNRSAT--GWGKRGSLPFKVVDER
1efuA           -------KPHVNVGTIGHVDHGKTTLTAAI-----------------TTVLAKT--------YGGTS---
3bb3A           -QFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFGLRPVMVSRTMGGF
3batA           ----------------------------------------------------------------------
3chuB           ---------------------------------------------------GSATLGRLVRAWPRRAA--
1c82A           ------------------------------------------------------DTYTDRLDDWNGIIAG
3chuA           -------------------------------------------------------------------ATL
2dbyA           -----------AVGIVGLPNVGKSTLFNALTRANAAANYPFATIDKNVG--VVPLEDERLYALQRTFAKG
3d5bF           -----------------RGTASTKTRGEVAYSGRKIWPQKHTG-------RARHGDIGAPIFVGGGVVFG
1cjtC           ------------------------------------------------------SDQDLLRCRVLTSGIF
3e3xA           ----------------------------------------------------------------------
3bb4A           -------------GFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSNSLIGEQVVRVSPFL
3dsnC           ----------------------------------------------------------------------
1d2eA           -------KPHVNVGTIGHVDHGKTTLTAAITKILAEGG-----GAKFKKYEEI-DNAPEERARGITINAA
1eg7B           -------------------------------------------------------LADYVVTEAGFGADL
2dwqA           ----------LAVGIVGLPNVGKSTL------FNALTRANALAATIDKNVGVVPLEDERLYALQRTFAKG
3dpbB           ----------------------------------------------------------------------
2dykA           ----------HKVVIVGRPNVGKSSLFNRLL-------------------------KKRSDLKEGVVETD
1byuB           ---QGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEK-----------------KYVPTLGVEVHPLVFH
2cxxB           -----------TIIFAGRSNVGKSTLIYRLTGKKVRRKIIEIE----WKNHKIIDPGFGFGL-------P
1aztB           -------------------------------------------------------DQDLLRCRVLTSGIF
1ecrA           FAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENR-----SS
3defA           --------------FQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNRVSPFQAGLRPV
2ahjD           -------------GGPFPLSRPSESEGRPAPVETTTFEVGQRVR------VRDEYVPGHIRMPAYCRGRV
3ea5C           ---------QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVAT--------------------LGVEVHPL
3a1vA           ----------VKVALAGCPNVGKTSLFNALTG----------------------TKQYVANWPGVTVEKK
1cjuC           ------------------------------------------------------SDQDLLRCRVLTSGIF
3c15C           ------------------------------------------------------SDQDLLRCRVLTSGIF
1d1nA           ----------------------------------------------------------------------
3dsnE           ----------------------------------------------------------------------
1a2kC           -------QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQ-
3dosE           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3a1sB           --------LHVKVALAGCPNVGKTSLFNA----------------------LTGTKQYVANWPGVTVEKK
2cxxC           ------------IIFAGRSNVGKSTLIYRLTGKKVRGVTRKIIEIEWKNHKIIDPGFGFGLPK-------
1ahjB           ---------------------------------RPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRV
3ea5A           -----EPQVQFKLVLVGDGGTGKTTFVKRHLT--------------------GEFEKKYVATLGVEVHPL
1cs4C           ------------------------------------------------------SDQDLLRCRVLTSGIF
2bkuA           ---------QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPT----LGVEVHPLVFHTNRGPIKFNVWDT
2cxxA           ------------IIFAGRSNVGKSTLIYRLTGKKVRRGKR---PGVTRKIIEIEWKNHKIIDPGFGFGLP
2a5fA           --------KEMRILMLGLDAAGKTTILYKLKL--------------------GQSVTTIPTVGFNVETVT
2atxA           ----GPGALMLKCVVVGDGAVGKTCLLMSYA---------------------------------------
3a1tA           -------------ALAGCPNVGKTSLFNALT---GTKQYVANWPG-----------VTVEKKEGV-----
1e5rB           ------------------------------------------------------WNAPTAHVEHVPYLKE
3a1vB           -----------KVALAGCPNVGKTSLFNALTGTKQYVANWPGV-----------------------TVEK
3a1uB           -----------KVALAGCPNVGKTSLFNALT---GTKQYVANTVEKKEGV--------------------
2ahjB           ----------SLAGGPFPLSRPSESEGRPAPVETTTFEV------GQRVRVRDEYVPGHIRMPAYCRGRV
3cb4D           ------------------KNIRNFSIIAHISTL---------------------SDRIIQICGGQSVTLD
3degC           ------MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMDLERERGI--TIKAQSVTLD


                         .         .         *         .         .         .         .:140
query           VMQFDYDGKRVNXLDTPGHEDFSEDTYRTLXXXXXXXXXXXXXKGIEAQTXKLFEVVKHRGIPVFTFMNK
2dy1A           VAPLLFRGHRVFLLDAPGYGDFVGEIRGALEAADAALVAVSAEAGVQVGTERAWTVAERLGLPRMVVVTK
2bm1A           --TCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
3dpuA           ENDDELKECLFHFWDFGGQEIMHASHQFFMTRSSVYMLLLDSRTDSNKHYWLRHIEKYGGKSPVIVVMNK
2bm0A           EVERSMRVLDGAIVVFDSSQGVEP------------------------QSETVWRQAEKYKVPRIAFANK
2efgA           ----FWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
2bv3A           VTTCFWKDHRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
1darA           -----WKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
2cnqA           ----------------------------------------------------------------------
2e1rA           KQKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
2brvX           NQYYDSK--------NDQMAKLNQELEGKVADSLSSILWEKFSNYKTSALTATYRKLEEMAKQVTNPSSR
2cnuA           ----------------------------------------------------------------------
2cnvA           ----------------------------------------------------------------------
1eftA           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
2cg8C           ----------------------------------------------------------------------
2b7cA           LWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGEHALLAFTLGVRQLIVAVNK
2c77A           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
1aipA           --EYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
2ahoA           SDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVAIIGVKNLIIVQNK
1b23P           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVFMNK
1d8tA           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
2bvnA           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
2d74A           CGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTRLMALQIIGQKNIIIAQNK
3cw2B           SDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQEHFVALGIIGVKNLIIVQNK
1d8tB           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
2c78A           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
3cb4D           ----------------------------------------------------------------------
1egaB           YQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPVILAVNK
2bvnB           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
1eg7A           YAGFKP-----DATVIV-ATVRALKMHGGVPKSDLATENLEALREGFANLEKHIENIGKFGVPAVVAINA
1aym1           VVPNINQSHPT----TSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESV
3dnfA           ----------------------------------------------------------------------
1efcA           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
1dg1G           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
2dcuA           CGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTRLMALQIIGQKNIIIAQNK
1aipE           -VEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREILLARQVGVPYIVVFMNK
3ec5A           VLEGTLTAEKTTLVVKEGTVTLSKNISKSGLNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFVQQ
3degC           ----------------------------------------------------------------------
2byeA           --RKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDY---FLMEEKYFISKEK
1eguA           NQYYDSNDQMAKLNQELEGKVA-----DSLSSISSQADRIYLWEKFSNYKTSANLTATYRKLEAKQVTNP
3a1sA           EGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNLLEILEEKKV---ILATA
1a4xB           DIPVDITDQKVDVLYTGRTVRAGMDALVDV-------------GRPSSIQLAVLVDRGHRELPIRADYIG
1egaA           YQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPVILAVNK
2e87A           DTPGLLDRPISERNEIEKQAILALRYLGNLIIYIFDPSEHCGFPLEEQIHLFEEVHGEFKDLPFLVVINK
3cwqA           QAAKYAPKYQ-NIVIDTQARPEDEDLEALADGCDLLVIPSTPDALALDALLTIETLQKLGNNRFRILLTI
1efuA           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
3bb3A           TINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQQTFGKEIWCKTLLVLTH
3batA           ---------------------------------------------------------EEEMKEQLKQMDK
3chuB           -VVNKADILDEWADYDTLVPDYPLEIVPFA--------EHPLFLAAEPHQRQRVLTGMWIGYNERVIATE
1c82A           NQYYDSNDQMAKLNQELEGK-----VADSLSSISSQADRIYLWEKFSNYKTSANLTATYRKKQVTNPSSR
3chuA           GRLVRAWPRRAAVVNKADILDEWADYDTLVPDYPLEIVPFAEHPAAEPHQRQRVLTGMWIGYNRVIATEQ
2dbyA           ERVPPVVPTHVEFVDIAGLVKGA-----------------------------------------------
3d5bF           P------KPRDYSYTLPKKVRKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSEVLLV
1cjtC           ETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDLFKSIWLRTISVILFLNK
3e3xA           ----------------------------------------------------------------------
3bb4A           MVSRTMGGFTINIIDTPGLVEAGIKGFLVNRTIDVLLYVDRLDVYRVDELDKTQTFGKEIWCKTLLVLTH
3dsnC           ----------------------------------------------------------------------
1d2eA           HVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGMPQTREHLLLARQIGVEHVVVYVNK
1eg7B           GAEKFYDVKCRYAGFKPDATVIVATVRALVPKSDLATENLEALREGFANLEKHIENIGKFGVPAVVAINA
2dwqA           ERVPPVVPTHVEFVDIAGLVKGA-----------------------------------------------
3dpbB           ----------------------------------------------------------------------
2dykA           RGRFLLVDTGGLWSGDKWEKKIQEKVDRALEDAEVVLFAVDGRAELTQADYEVAEYLRRKGKPVILVATK
1byuB           TNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNK
2cxxB           KEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNK
1aztB           ETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIFKSIWNNRWLRTISVILFLNK
1ecrA           KAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRT
3defA           MVSRTMGGFTINIIDTPGLVEALIKGFLVNRTIDVLLYVDRLDVYAVDELDKQVTFGKEIWCKTLLVLTH
2ahjD           GTISHRTTEKWPFPDAIGHGRND-----------------------------------------------
3ea5C           VFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDVCENIPIVLCGNK
3a1vA           EGVFTYKGYTINLIDLPGTYSLGYSSIDEKLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTA
1cjuC           ETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDIWNNRWLRTISVILFLNK
3c15C           ETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIFKSIWNNRWLRTISVILFLNK
1d1nA           ----------------------------------------------------------------------
3dsnE           ----------------------------------------------------------------------
1a2kC           -EKFGGLRDGYYIQAQCAIIMFDVTSRVTY---------------KNVPNWHRDLVRVCENIPIVLCGNK
3dosE           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3a1sB           EGVFTYKGYTINLIDLPGTYSLGEKIARDYLLKGDADLVILVADSVNPEQYLLLEILEEKKVILATAIDE
2cxxC           -EVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNK
1ahjB           GTISHRTTEKWPFPDAIGHGRND-----------------------------------------------
3ea5A           VFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLC
1cs4C           ETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDIWNNRWLRTISVILFLNK
2bkuA           AGQEKFGGLRDGYYIQAQCAIIMFD-------------VTSRVTYKNVPNWHRDLVRVCENIPIVLCGNK
2cxxA           KEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNK
2a5fA           YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANK
2atxA           ----------------------------------------------------------------------
3a1tA           ---FTYKGYTINLIDLPGTYSLGEKIARDYLLKGDADLVILVADSVNEQSLYLLLEILEMEKKVILAMTA
1e5rB           IVTTVFDGTHLQMAIVIPHRDFVERYFRTFMVLEDSPLAFHSNEDTVIDAATVHSAVNFSEISRQSLCVD
3a1vB           KEVFTYKGYTINLIDLPGTYSLGYSSIDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTK
3a1uB           ---FTYKGYTINLIDLPGTYSLGYSSRDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTA
2ahjB           GTISHRTTEKWPFPDAIGHGRND-----------------------------------------------
3cb4D           YKASDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNK
3degC           YKASDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNK


                         +         .         .         .         .         *         .:210
query           LDRDGREPLDLLQELEEILGIASYPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNP
2dy1A           LDKGGDYYALLEDLRSTLGPIL--PIDLPLYEGGKWVGLIDVFHGKARYENGEEREAEVPPEERRFRQEV
2bm1A           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDPIPEEYLDQAREYHEKL
3dpuA           IDENPSYNIEQKKINERFPAIENRFHRISKSAVLHPDSIYGTPLAPSWIKVKEKLVEATTAQRYLN--RT
2bm0A           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDL----GTDIREIPIPEE
2efgA           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDPIPEEYLDNAREYHEKL
2bv3A           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTEEYLDQAREYHEKL
1darA           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDPIPEEYLDQAREYHEKL
2cnqA           ----------------------------------------------------------------------
2e1rA           VDRALLELQVSKEDLYQTFARTVESVNVIVST--------------------------------------
2brvX           YYQDETVVRTVRDSMEWMHKHVYNSEKSIVGNWWDYEIGTPRAINNFSDEEIKKYTDVIEKFV--PDPEH
2cnuA           ----------------------------------------------------------------------
2cnvA           ----------------------------------------------------------------------
1eftA           VDMVDDPELLDLVEMEVRDLL--NQYEFPGDEVPVIRGSALLALEEMHKNPKTKRG--------------
2cg8C           ------------------------FAYHGLFPSEKELGQKFIVS--AILSYDMTKAATDLDLTASVHYGE
2b7cA           MDSVKWDESRFQEIVKETSNFIKKVGYNPKTVGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTL----
2c77A           VDMVDDPELLDLVEMEVRDLL--NQYEFPGDEVPVIRG--------------------------------
1aipA           VDMVDDPELLDLVEMEVRDQYEFPGDEVPVIRGSALLALEQMH---------------------------
2ahoA           VDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINI-----------------------------
1b23P           VDMVDDPELL--DLVEMEVRDLLNQYEFPGDEVPVIRGSALLALEEMHKNPKTKRGENEWVDKIWE----
1d8tA           CDMDDEELLELVEEVRELL---------------------------------------------------
2bvnA           CDMDDEELLELVEEVRELLSQYDFPGDDT-----------------------------------------
2d74A           IELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHG--------------------------------
3cw2B           VDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSAL----------------------------------
1d8tB           CDMDDEELLELVEEVRELL---------------------------------------------------
2c78A           VDMVDDPELLDLVEMEVRDLL--NQYEFPGDEVPVIRGSALLALEQMHRNPKTRRG--------------
3cb4D           ----------------------------------------------------------------------
1egaB           VDNVQEKADLLPHLQFLASQMNFLDAETGLNVDTIAAIVRKHLPEATHHFDRSQRFMASEIIREKLMRFL
2bvnB           CDMDDEELLELVEEVRELL---------------------------------------------------
1eg7A           FPTDTEAELNLLYELCAKAGAEVALSWAKGGEGELARKVLQTL---------------------------
1aym1           LDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDS-------------------------------
3dnfA           ----------------------------------------------------------------------
1efcA           CDMDDEELLELVEEVRELL---------------------------------------------------
1dg1G           CDMDDEELLELVEEVRELL---------------------------------------------------
2dcuA           IELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANID----------------------------
1aipE           VDMVDDPELLDLVEMEVRDLLNQYGDEVPVIRGSALLALEQM----------------------------
3ec5A           YDSNGTSLEGSAVEITK-----------------------------------------------------
3degC           ----------------------------------------------------------------------
2byeA           NECRKQPFQRAIGPEEEIMQILS-SWFPEEGYMGRI----------------------------------
1eguA           SSRYYQDERTVRDSMEWMHKHVYNSEKSIVGNWWDYEIGTP-----------------------------
3a1sA           IDEAKKTGKIDRYELQKHLGIPVVFTSSVEGLEELKEKIVEYAQKNTILHRILDYGEKVEDKKLRINPRY
1a4xB           KNIPTSKSEKVMVQLDEVDQNDL-----------------------------------------------
1egaA           VDNVQEKADLLPHLQFLASQMNFLDIVPISNVDTIAAYITDRSQRFMASEIIREKLMRFLGAELPYSVTV
2e87A           IDVADEENIKRLEKFVKEKGLNPIKISALKGTGLVKEEIIKTLRPLAEKVAREKIERELR----------
3cwqA           IPPYPSKDGDEARQLLTTAGLPLFKRGIKRYS--------------------------------------
1efuA           CDMDDEELLELVEEVRELL---------------------------------------------------
3bb3A           AQFSPPDELSYETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEK---------
3batA           MKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEV----------------
3chuB           QLIAEPAFDLVMHGVFPGSDDPLIRKSVQQAI--------------------------------------
1c82A           YYQDETVVRTVRDSMEWMHKHVYNSEKSIVGNWWDYEI--------------------------------
3chuA           LIAEPAFDLVMHGVFPGSDDPLIRVQQAIVDESFHTYMHML-----------------------------
2dbyA           ----------------------------------------------------------------------
3d5bF           TGNELNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRI---------------------------
1cjtC           QDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGED--------------------------------
3e3xA           ----------------------------------------------------------------------
3bb4A           AQFSPPDELSYETFSSKRSDELLKTIRAGSKMRKQEFE--------------------------------
3dsnC           ----------------------------------------------------------------------
1d2eA           ADAVQDSEMVELVELE------------------------------------------------------
1eg7B           FPTDTEAELNLLYELCAKAGAEVALSWAKGGEGELARKVLQTL------ESRPSNFHVLYNLDLSIKDKI
2dwqA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
2dykA           VDDPKHEPLYGL----GFGDPIPTSSEHARGLEELLEAIWER----------------------------
1byuB           VDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNKPFLWLARKLIGDPNLEFVAMP---------------
2cxxB           LDKIKNVQEVINFLAEKFEVPL-SEIDKVFNIERLKNRIFEVIRER------------------------
1aztB           QDLLAEKVLAGKSKIEDYFPEFARYTTPED--ATPEPGEDPRV-TRAKYFIRDEFLRISTASGDGRHYCY
1ecrA           LTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSL----------------------------------
3defA           AQFSPPDELSYETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEK---------
2ahjD           ----------------------------------------------------------------------
3ea5C           VDIKDRKVKAKSIVFHRKKNLQYYDISANYNFEKPFLWLARKLIGDPNLE--------------------
3a1vA           IDAKKTGMKIDRYELQKHLGIPVVFTSTGEGLEELKEKIVEYAQKNTHRMILDYGEKVESEIKKV-----
1cjuC           QDLLAEKVLAGKSKIEDYFPEFARYTTPEPGEDPRVTRAKY-FIRDEFLRISTASGDGRHYCYPHFTCAV
3c15C           QDLLAEKVLAGKSKIEDYFPEFARYTTPEPGEDPRVTRAKY-FIRDEFLRISTASGDGRHYCYPHFTCAV
1d1nA           ----------------------------------------------------------------------
3dsnE           ----------------------------------------------------------------------
1a2kC           VDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNKPFLWLARKLIGDPNLEFVAMP---------------
3dosE           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3a1sB           AKKTGKID---RYELQKHLGIPVVFTSSVTG-----EGLEELKEKIVEYAQKNTILHILDYGEKV-----
2cxxC           LDKIKNVQEEKFEVPLSEIDKVFIPISFGDNIERLKNRIFEVIRER------------------------
1ahjB           ----------------------------------------------------------------------
3ea5A           GNKVDIKDRKVKAKSIVFHRKKNLQYYDNYNFEKPFLWLARKLIGDPNLEF-------------------
1cs4C           QDLLAEKVLAGKSKIEDYFPEFARYTTPEDA---------------------------------------
2bkuA           VDIKDRKVKAKSIVFHRKKNLQYYDISANYNFEKPFLWLARKLIGDPNLE--------------------
2cxxA           LDKIKNVQEVINFLAEKFEVPLSEIDKVGDNIERLKNRIFEVIRER------------------------
2a5fA           QDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY--------------------
2atxA           ----------------------------------------------------------------------
3a1tA           IDEAKKTGMKIDRYLQKHLGIPVVFTSTGEGLEELKEKIVEYAQKNTILHR-------------------
1e5rB           FAFDGPFDEKEIFA-DATLYAPGSTPDLPERRPFTAEHRRRILSLGQVIERENFRDILFLLSKVHYKYDV
3a1vB           KTGMKIDRYELQKHLGIPVVFTSSVTG--EGLEELKEKIVEYAQKNTILHRMILDY--------------
3a1uB           IDEAKKTGMKIRYELQKHLGI-------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3cb4D           IDLPAADPERVAEEIEDIVGIDATDAKTGVGVQDVLERLVR-----------------------------
3degC           IDLPAADPERVAEEIEDIVGIDATDAKTGVGVQDVLERLVR-----------------------------


                         .         .         .         +         .         .         .:280
query           FYEQVKDDIELLNEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGEIVDP
2dy1A           LEAIVETDEGLLEEALEKAFHEAVRRGLLYPVALASGEREIGVLPLLELILEALPSPTER---------F
2bm1A           VEVAADFDENIMLKYLEAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIEGEVVEI
3dpuA           EVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEVLDPHWVTIGVYRIINS-SKTKNGHLNTSA
2bm0A           VEVAADFDENIMLKYLVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIEGEVVEI
2efgA           VEVAADFDENIMLKYGEEPTEEELIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIEGEVVEI
2bv3A           VEVAADFDENIMLKYGEEPTEEELIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIEGEVVEI
1darA           VEVAADFDENIMLKYLVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTVVEI
2cnqA           ------------------------LDGILPLVARGKVRDIYEVDALLFVATDRISAYDVIMENSIPEKGI
2e1rA           -MNFKKDEIPVLLEKLEIVLKGDEKDLEGKALLKVVMRKFLPAADALLEMIVLHLPSPVTAQDANCIAIK
2brvX           FRKTTDNPFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDHTNVAY
2cnuA           ------------------------LDGILPLVARGKVRDIYEVDALLFVATDRISAYDVIMENSIPEKGI
2cnvA           -----------------------ELDGILPLVARGKVRDIYEVDAGTLLFVATDRIS-AYDVIMENSIPE
1eftA           ----------------------------------------------------------------------
2cg8C           LCQQWTTWIETVAYKLVERTFESYPAPVHLSLDTCSVTIHRRKQRAFIALGSNMGDKQRARGIHILKESS
2b7cA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
3cb4D           ------------------------------DAVRCSAKTGVGVQDVLERLVRDIPPPEGDPE--------
1egaB           GAYSVTVEIERFVSNERGGYDEREGQKKMVIGNKGAKIKTIGIEARKDMQFEAPVHLELWVKVK-SGWAD
2bvnB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
3dnfA           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
3degC           ------------------------------DAVRCSAKTGVGVQDVLERLVRDIPPPEGDPE--------
2byeA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
3a1sA           FALKYLGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEA--------------------
1a4xB           ----------------------------------------------------------------------
1egaA           EIERFVSNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQFEAPVHLELWVKVKSGWADD
2e87A           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3e3xA           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------TDAAGDPMYLTFTS---------Q
1d2eA           ----------------------------------------------------------------------
1eg7B           AKIATEIYGADGVNYTAEADKAIQRYESLGYGNLPVVMAKTQYSFSDDMTKLGRPRNF-----TITVREV
2dwqA           ----------------------------------------------------------------------
3dpbB           -------------------------------------------------------------FTDAAGDPL
2dykA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1aztB           PHFTCAVDTENIRRVFNDCRDIIQ----------------------------------------------
1ecrA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1cjuC           DTENIRR---------------------------------------------------------------
3c15C           DTENIRR---------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
3dsnE           ------------------------------------------------------------------YLTF
1a2kC           ----------------------------------------------------------------------
3dosE           ---------------------------------------------------------------------F
3bjqE           ----------------------------------------------------------------------
3a1sB           -ESEIKKVENFLRDKKLRINPRYF----------------------------------------------
2cxxC           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1e5rB           HETYDWLIEISKQAGDEKMVVEARALSE------------------------------------------
3a1vB           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YDKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAESRENVINAVA
2dy1A           GDGPPLAKVFKVQVDP---FMGQVAYLRLYRGRLKPGDSLQSEAGQV--RLPHLYVPMGKDLLEVEEAEA
2bm1A           HPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
3dpuA           LGYILNEEKF---TYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIITEGEPLRTIIPRLMIAMQ
2bm0A           HPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
2efgA           HPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
2bv3A           HPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
1darA           HPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
2cnqA           LLTKLSEFWFKFLSNDVRNH---LVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVR
2e1rA           NCDPKADLMLYVSKMVPTSDKGRYAFGRVFAGTVKSGQKVRIQGPNYVPGIQRVVLMMGRFVEPIDDCPA
2brvX           TGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFAPLLVNGELMDMSRGRSISRANSEGHVA
2cnuA           LLTKLSEFWFKFLSNDVRNH---LVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVR
2cnvA           KGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVR
1eftA           ----------------------------------------------------------------------
2cg8C           VLASFANQVVEVETWLPAQD----LLETLLAIESELGRLILLFVEDQILYTDDLILPHPYIAE-RLFVLE
2b7cA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
3cb4D           -----GPLQALIIDSWFDNYLGVVSLIRIKNGTLRKGDKVKVMSTGQTYNALGIFTPKQVDRTELKCGEV
1egaB           DERALRSL--------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
3dnfA           -------------------------------------------------IIAEHAGFCFGVKRAVLKESQ
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
3degC           -----GPLQALIIDSWFDNYLGVVSLIRIKNGTLRKGDKVKVMSTGQTYNADRLGTPKQVDRTELKCGEV
2byeA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
1egaA           -ERALRSL--------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3e3xA           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3dsnC           DGNNHQFTTKVIG-----KDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSK----GGKLAAGKY
1d2eA           ----------------------------------------------------------------------
1eg7B           RLSAGGRLIVPITGAIMPGLPKRPAACNID----------------------------------------
2dwqA           ----------------------------------------------------------------------
3dpbB           TFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSK----GGKLAAGKY
2dykA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1d1nA           YEEKVIGQ-AEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGIVVYEGEIDSLKRY-KDDVREVAQ
3dsnE           TSQDGNNHQFTTKVIGKDSRDFDISP--KVNGENLVGDDVVLATGSQDFFVRSIGSK----GGKLAAGKY
1a2kC           ----------------------------------------------------------------------
3dosE           TSQDGNNHQFTTKVIGK--DSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSK----GGKLAAGKY
3bjqE           -------------------GEPNRLLSRKALSACKYHPKLIERVKYTRAE---SITIDLKALWEVEEIVV
3a1sB           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1e5rB           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQKSFHKGIEQLVQEGAIQLYKN
2dy1A           GFVLGVPKAEGLHRGMVLWQGEKSEEVPFARLPDPNVPVALHPKGRTDEARLGEALRKLLEEDPSLKLEQ
2bm1A           GDLGAVVGLKETITGDTLVGEDAPRVLESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEPTFRVSTH
3dpuA           HQILDRMQWRYGMV-LKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLD
2bm0A           GDLGAVVGLKETITGDTVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSH
2efgA           GDLGAVVGLKETITGDTLVGEDAESVGKPQVAYRETITKPVDVEGKFIRQTGGRGQVKIKVEPLPRGSGF
2bv3A           GDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDV-----------------AIEPSPTFSVSTH
1darA           GDLGAVVGLKETITGDTLVGEDAVILEEEDPTFRVSTQTIISGMGELKREFKVDANVGQVAYRETITKPV
2cnqA           GYITGSAWKEYVKTGTVHGLKQPQ-GLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAEA
2e1rA           GNIIGLVGIDQFLLKTGTLTTSETAHNMKVMKFSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYM
2brvX           AVEVLRGIHRIADMSEGETKQRLQSLVKSDSYYDVFKNLKASVPRTSYLSAFNKMDKTAMYNAEKGFGFG
2cnuA           GYITGSAWKEYVKTGTVHGLKQPQ-GLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAEA
2cnvA           GYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTK----DENISPAQAAELVGEDLSRRVELA
1eftA           ----------------------------------------------------------------------
2cg8C           SLQPHFIHPIL---KQPIR---------------------------------------------------
2b7cA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
3cb4D           GWLVCAIKDIHGAPVGDTLTLARNPAEKALPGFKKQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEE
1egaB           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
3dnfA           GKVYTLKNLGVFSQGEEFKEGDTIIRSHGIPPEKEEALLKVIDATCPYVKAVHEAVCQLTREGYFVVLVG
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
3degC           GWLVCAIKDIHGAPVGDTLTLARNPAEKALPGFKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEP
2byeA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3e3xA           ---------------------------EPTVTTFQVNTSPFAGEGFVTSRNILERLEKELVHNALRVEQT
3bb4A           ----------------------------------------------------------------------
3dsnC           TDAVTV----------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
3dpbB           TDAVTV----------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1d1nA           GYECGLTIKNDIKEGDVIEA--------------------------------------------------
3dsnE           TDAVTV----------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
3dosE           TDAVTV----------------------------------------------------------------
3bjqE           GTARVATDSFGDVWGPDVWLGYVS-DNPDPSVEEPSFGYTYQIEG-------------------------
3a1sB           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1e5rB           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPMGKKTVRWIKPEDLDERMSSSRNXLAKDRFDQPVF
2dy1A           EETGELLLWGHGELHLAT-AKERLQDYGVEVEFSVPKVPYRETIKKVAEGQGKYGQYGDVWLRLEPASEY
2bm1A           PETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKF----------------
3dpuA           VKEFIPLPGHPD-ELVEYK-ELLGLEKMGRDRYV--SGKLEKVFSVSKMLDSVIS---------------
2bm0A           PETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKF----------------
2efgA           EFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTL--------------------------
2bv3A           PETGSTIISGMGELSLEIIVVGKPQVAYRETITKPVDVEGKFIR--------------------------
1darA           DVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPV-
2cnqA           VKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVPDSSRFWSQDSYDKQF--LRDWLTANKLNGVNG
2e1rA           SESGEHIVAGTGELHLEICLQDLEHDAGVPLKISPPVVAYRETVESESSQTALSKSPN------------
2brvX           LSLFSSRTLNYEHMNKENKRGWYTSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETDAKRADSDTGKV
2cnuA           VKLYSKCKDYAKEKGIIIADTKFEFGIDEKT---------------------------------------
2cnvA           VKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNASYKVGESQDSYDKQFLRDW
1eftA           ----------------------------------------------------------------------
2cg8C           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
3cb4D           SSSAGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTSRE----------------------
1egaB           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
3dnfA           EKNHPEVIGTLGYLACNGKGIVVETLEDIGEALKHERVGIVAQTTQNEEFFKE-----------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
3degC           ESSSAFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKL------------
2byeA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3e3xA           DDPDKFRVSGRGELHLSILIENRREGFELAVSRPEVIIEEDGQLEPFETVTID-----------------
3bb4A           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
3dsnE           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1e5rB           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LFENDFALRWFADKYPDVxxxxxx
2dy1A           GFEWRITGGVIPSKY---------
2bm1A           ------------------------
3dpuA           ------------------------
2bm0A           ------------------------
2efgA           ------------------------
2bv3A           ------------------------
1darA           ------------------------
2cnqA           VKMPQDIVDRTRAKYIEA------
2e1rA           ------------------------
2brvX           LPSAFVGTSKLDDAN---------
2cnuA           ------------------------
2cnvA           LTANKLNGVNGVKMPQDI------
1eftA           ------------------------
2cg8C           ------------------------
2b7cA           ------------------------
2c77A           ------------------------
1aipA           ------------------------
2ahoA           ------------------------
1b23P           ------------------------
1d8tA           ------------------------
2bvnA           ------------------------
2d74A           ------------------------
3cw2B           ------------------------
1d8tB           ------------------------
2c78A           ------------------------
3cb4D           ------------------------
1egaB           ------------------------
2bvnB           ------------------------
1eg7A           ------------------------
1aym1           ------------------------
3dnfA           ------------------------
1efcA           ------------------------
1dg1G           ------------------------
2dcuA           ------------------------
1aipE           ------------------------
3ec5A           ------------------------
3degC           ------------------------
2byeA           ------------------------
1eguA           ------------------------
3a1sA           ------------------------
1a4xB           ------------------------
1egaA           ------------------------
2e87A           ------------------------
3cwqA           ------------------------
1efuA           ------------------------
3bb3A           ------------------------
3batA           ------------------------
3chuB           ------------------------
1c82A           ------------------------
3chuA           ------------------------
2dbyA           ------------------------
3d5bF           ------------------------
1cjtC           ------------------------
3e3xA           ------------------------
3bb4A           ------------------------
3dsnC           ------------------------
1d2eA           ------------------------
1eg7B           ------------------------
2dwqA           ------------------------
3dpbB           ------------------------
2dykA           ------------------------
1byuB           ------------------------
2cxxB           ------------------------
1aztB           ------------------------
1ecrA           ------------------------
3defA           ------------------------
2ahjD           ------------------------
3ea5C           ------------------------
3a1vA           ------------------------
1cjuC           ------------------------
3c15C           ------------------------
1d1nA           ------------------------
3dsnE           ------------------------
1a2kC           ------------------------
3dosE           ------------------------
3bjqE           ------------------------
3a1sB           ------------------------
2cxxC           ------------------------
1ahjB           ------------------------
3ea5A           ------------------------
1cs4C           ------------------------
2bkuA           ------------------------
2cxxA           ------------------------
2a5fA           ------------------------
2atxA           ------------------------
3a1tA           ------------------------
1e5rB           ------------------------
3a1vB           ------------------------
3a1uB           ------------------------
2ahjB           ------------------------
3cb4D           ------------------------
3degC           ------------------------