[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56337.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2amlA.bssp"
#ERROR : Can't open dsspfile "2cvpA.bssp"
#ERROR : Can't open dsspfile "1c7rA.bssp"
#ERROR : Can't open dsspfile "2cb0B.bssp"
#ERROR : Can't open dsspfile "1b0zA.bssp"
#ERROR : Can't open dsspfile "2cb0A.bssp"
#ERROR : Can't open dsspfile "3c3jB.bssp"
#ERROR : Can't open dsspfile "2a3nA.bssp"
#ERROR : Can't open dsspfile "3c3jE.bssp"
#ERROR : Can't open dsspfile "2bplA.bssp"
#ERROR : Can't open dsspfile "2df8B.bssp"
#ERROR : Can't open dsspfile "3c3jC.bssp"
#ERROR : Can't open dsspfile "3c3jA.bssp"
#ERROR : Can't open dsspfile "2decA.bssp"
#ERROR : Can't open dsspfile "3cvjC.bssp"
#ERROR : Can't open dsspfile "2amlB.bssp"
#ERROR : Can't open dsspfile "3cvjA.bssp"

## Summary of PDB Search
:269
    2e-17  21%  2amlA  [x.x.x] SIS DOMAIN PROTEIN
    3e-16  13%  2cvpA  [x.x.x] GLUCOSE-6-PHOSPHATE ISOMERASE
    4e-14  11%  1c7rA  [c.80.1] PHOSPHOGLUCOSE ISOMERASE
    2e-13  18%  2cb0B  [x.x.x] GLUCOSAMINE-FRUCTOSE-6-PHOSPHATE
    6e-13  11%  1b0zA  [c.80.1] PROTEIN (PHOSPHOGLUCOSE ISOMERASE)
    2e-12  18%  2cb0A  [x.x.x] GLUCOSAMINE-FRUCTOSE-6-PHOSPHATE
    6e-11  14%  3c3jB  [x.x.x] PUTATIVE TAGATOSE-6-PHOSPHATE KETOSE/ALDOSE
    2e-10  16%  2a3nA  [x.x.x] PUTATIVE GLUCOSAMINE-FRUCTOSE-6-PHOSPHATE
    2e-10  15%  3c3jE  [x.x.x] PUTATIVE TAGATOSE-6-PHOSPHATE KETOSE/ALDOSE
    6e-10  19%  2bplA  [d.153.1 - c.80.1 (1jxaA)] GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE
    8e-10  23%  2df8B  [x.x.x] 325AA LONG HYPOTHETICAL PROTEIN
    9e-10  17%  3c3jC  [x.x.x] PUTATIVE TAGATOSE-6-PHOSPHATE KETOSE/ALDOSE
    4e-09  15%  3c3jA  [x.x.x] PUTATIVE TAGATOSE-6-PHOSPHATE KETOSE/ALDOSE
    6e-08  22%  2decA  [x.x.x] 325AA LONG HYPOTHETICAL PROTEIN
    6e-08  22%  3cvjC  [x.x.x] PUTATIVE PHOSPHOHEPTOSE ISOMERASE
    2e-07  21%  2amlB  [x.x.x] SIS DOMAIN PROTEIN
    3e-07  19%  3cvjA  [x.x.x] PUTATIVE PHOSPHOHEPTOSE ISOMERASE
:269

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKELIPMIEANLPNMAYAEKDIAKFFLKQQPLNDYSSKALCEYLNVSKATLTRFAKKCGFKGFRQFI
2amlA           ----------------------------------------------------------------------
2cvpA           ----RELFEADPERFNNFSLNLNTNHGHILVDYSKNLVSKEVMAKSRGVEAARDNMFSGSKINYTEDRAL
1c7rA           -------------------------------------------------------SFDYSNALPFMQENE
2cb0B           ----------------------------------------------------------------------
1b0zA           -------------------------------------------------------SFDYSNALPFMQENE
2cb0A           ----------------------------------------------------------------------
3c3jB           ----------------------------------------------------------------------
2a3nA           ----------------------------------------------------------------------
3c3jE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
2df8B           ----------------------------------------------------------------------
3c3jC           ----------------------------------------------------------------------
3c3jA           ----------------------------------------------------------------------
2decA           ----------------------------------------------------------------------
3cvjC           ----------------------------------------------------------------------
2amlB           ----------------------------------------------------------------------
3cvjA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FKYQEMIHEKEKLALYTEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYGKGSSVLALQE
2amlA           ---------------------TTYINEEEECRVILADFQTNAEKLESLVKNGAKEWLILATGSSLNAAQS
2cvpA           HVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGSDLGPLMVTE
1c7rA           LDYLSEFVKAAHHMLHERKGPGSDFLGWDWPIRYDKNEFSRIKQAAERIRNHSDALVVIGIGGSYLGARA
2cb0B           -----------------------------TLTEIKQTPKGIIFNQVKDKIRLPRRILYLGCGSSHFLAKL
1b0zA           LDYLSEFVKAAHHML-HERKGSDFLGWVDWPIRYDKNEFSRIKQAAERIRNHSDALVVIGIGGSYLGARA
2cb0A           -----------------------------TLTEIKQTPKGIIFNQVKDKIRLPRRILYLGCGSSHFLAKL
3c3jB           ---EEEIRHQP------RAWIRSLTNIDALRSALNNFLEPLLRKE-------NLRIILTGAGTSAFIGDI
2a3nA           -----------------------------NQDEYLTSAREIIRQKAEQVADEFSSLFFASVGGSLAPAIN
3c3jE           ---EEEIRHQP------RAWIRSLTNIDALRSALNNFLEPLLRKE-------NLRIILTGAGTSAFIGDI
2bplA           -------------------------------------DLSELGPNADELLSKVEHIQILACGTSYNSGMV
2df8B           ----------------------------KTLIEIKQTPDGIIFNKVKDKISLPNRILYLGCGSSHFLSKL
3c3jC           ----------------------------RAWIRSLTNIDALALNNFLEPLKENLRIILTGAGTSAFIGDI
3c3jA           ---EEEIRHQP------RAWIRSLTNIDALRSALNNFLEPLLRKE-------NLRIILTGAGTSAFIGDI
2decA           -------------------TLIEIKQTPDGIIKA-----DKVFNKVKDKISLPNRILYLGCGSSHFLSKL
3cvjC           ----------------TSSFTDYCKFFNRILSEVQETQEQ-AIIKGAHLVSEAGRFYVFGSGHSHIA-EE
2amlB           --------------------------YINEEEECRVILADFQAEKLESLVKNAKEWLILATGSSLQSAKY
3cvjA           ----------------TSSFTDYCKFFNRILSEVQETQEQ-AIIKGAHLVSEAGRFYVFGSGHSHIAEEA


                         +         .         .         .         .         *         .:210
query           MKMRFMRLGVIGEVLSDEDMILWSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTTRKxxx
2amlA           AKYYIENLADVRITIEEPFNHLYYEKLSSHLDLVIGISQSGQSTSTISALERVKEASVPVVALTSDV---
2cvpA           ALKPYSKGGPRVWFVSGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDP------
1c7rA           AIEALSTQIYAGQNISSTYISHLLDVLEGKDLSINVISKSGTTTEPAIAFRIFRDYMEKKYGKEEAR---
2cb0B           LAVTNHGGTGVALP-CSEFLYSKEAYPIGKPELVVGISRSGETTEVLLALEKINTPKLGISAYE------
1b0zA           AIEALSHTFHNGQNISSTYISHLLDVLEGKDLSINVISKSGTTTEPAIAFRIFRDYMEKKYGKE------
2cb0A           LAVTNHGGTGVALP-CSEFLYSKEAYPIGKPELVVGISRSGETTEVLLALEKINTPKLGISAYE------
3c3jB           IAPWLASHTNFSAVPTTDLVTNPDYLNPAHPLLLISFGRSGNSPESVAAVELANQFVPECYHLP------
2a3nA           EFAKELT-TLPVYVEQAAELIHKGNKRLNKDSVVITLSKSGDTKESVAIAEWCKAQGIRVVAITKNA---
3c3jE           IAPWLASHTNFSAVPTTDLVTNPDYLNPAHPLLLISFGRSGNSPESVAAVELANQFVPEHLPITCNE---
2bplA           SRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAIC-----
2df8B           LAMVTNMHGGLGIALPCEFLYSKETYPIGEVELAVGISRSGET---TEILLALEKINVKKLGIT------
3c3jC           IAPWLASHTGKNFSAVPDLVTNPDYLNPAHPLLLISFGRSG-----------------------------
3c3jA           IAPWLASHTNFSAVPTTDLVTNPDYLNPAHPLLLISFGRSGNSPESVAAVELANQFVPEHLPITCN----
2decA           LAMVTNMHGGLGIALPCEFLYSKETYPIGEVELAVGISRSGET---TEILLALEKINVKKLGIT------
3cvjC           IYNRAGGLALVTAILPPELLHERPNLHQVTNKDVIIISNSGRNTVPVE-AIESRNIGAKVIATSKHS---
2amlB           YIENLADVRITIEEPFNH---LYYEKLSSHLDLVIGISQSGQSTSTISALERVKKESVPVVALT------
3cvjA           GGLALVTAILPPELLHERPNKSYLKLHQVTNKDVIIISNSGRNTVPVE-AIESRNIGAKVIATSKHS---


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2amlA           -----------------------------------------------------------
2cvpA           -----------------------------------------------------------
1c7rA           -----------------------------------------------------------
2cb0B           -----------------------------------------------------------
1b0zA           -----------------------------------------------------------
2cb0A           -----------------------------------------------------------
3c3jB           -----------------------------------------------------------
2a3nA           -----------------------------------------------------------
3c3jE           -----------------------------------------------------------
2bplA           -----------------------------------------------------------
2df8B           -----------------------------------------------------------
3c3jC           -----------------------------------------------------------
3c3jA           -----------------------------------------------------------
2decA           -----------------------------------------------------------
3cvjC           -----------------------------------------------------------
2amlB           -----------------------------------------------------------
3cvjA           -----------------------------------------------------------