[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56378.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2bsqE.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "2bsqH.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "1a2kD.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "3c94A.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"

## Summary of PDB Search
:210
    4e-35  22%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-34  10%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-34  22%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-32  12%  3cmvH  [x.x.x] PROTEIN RECA
    4e-31  12%  3cmvG  [x.x.x] PROTEIN RECA
    6e-31   9%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    1e-29  10%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-28   7%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-28   9%  2bifA  [c.37.1 - c.60.1] PROTEIN
    2e-28   7%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    3e-28   9%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    3e-28  16%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-28  18%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    7e-28  13%  3cmvC  [x.x.x] PROTEIN RECA
    1e-27  24%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    2e-27  11%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-26  10%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    7e-26   9%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    9e-26   5%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-25  16%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-25  14%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    1e-25  10%  2akaB  [x.x.x] DYNAMIN-1
    3e-25  12%  3cmvA  [x.x.x] PROTEIN RECA
    3e-25  17%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    6e-25  11%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    9e-25  12%  2b8tA  [x.x.x] THYMIDINE KINASE
    9e-25  12%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-24  11%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    2e-24  15%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-24  17%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-24  13%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-24  10%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    5e-24   9%  1aroP  [e.8.1] T7 RNA POLYMERASE
    5e-24  10%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-23  11%  2ctsA  [x.x.x] CITRATE SYNTHASE
    3e-23  10%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    6e-23  12%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    6e-23  13%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    9e-23  14%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-22  15%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    2e-22   8%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-22   6%  2cgtH  [x.x.x] 60 KDA GROEL
    2e-22   7%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-22   8%  1e98A  [c.37.1] THYMIDYLATE KINASE
    5e-22  10%  4dcgA  [x.x.x] VP39
    5e-22   9%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    6e-22  24%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    6e-22  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    8e-22   7%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    9e-22  11%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    1e-21   7%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    1e-21  11%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    2e-21  12%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-21  16%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-21   7%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    3e-21  17%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    4e-21   9%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-21  10%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    1e-20  14%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-20  13%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-20  10%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-20  28%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-20   8%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-20  10%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-20  12%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    2e-20  12%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    3e-20  10%  1e0jB  [c.37.1] DNA HELICASE
    3e-20   8%  3adkA  [x.x.x] ADENYLATE KINASE
    4e-20  16%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-20  11%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    6e-20  34%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    7e-20  10%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    9e-20   9%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    2e-19  14%  2bdtA  [x.x.x] BH3686
    2e-19  13%  2cckA  [x.x.x] THYMIDYLATE KINASE
    2e-19  14%  3cm0A  [x.x.x] ADENYLATE KINASE
    2e-19  10%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    3e-19   8%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    3e-19   9%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    4e-19   7%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-19   9%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    5e-19  12%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    5e-19   9%  421pA  [x.x.x] H-RAS P21 PROTEIN
    6e-19  11%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    6e-19  10%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    8e-19   7%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    8e-19   7%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    8e-19   9%  2axzC  [x.x.x] PRGX
    9e-19  13%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-18  13%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    1e-18   9%  1e0jA  [c.37.1] DNA HELICASE
    2e-18   9%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-18  29%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-18  17%  3c8uA  [x.x.x] FRUCTOKINASE
    4e-18  12%  3cmtD  [x.x.x] PROTEIN RECA
    4e-18  11%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    5e-18  15%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-18  12%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-18  14%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-18  11%  3da4A  [x.x.x] COLICIN-M
    9e-18  13%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-17  11%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-17  11%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-17  15%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-17  10%  1e6cA  [c.37.1] SHIKIMATE KINASE
    2e-17  10%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-17  10%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    2e-17  13%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-17  14%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    4e-17  10%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-17  13%  3cmxA  [x.x.x] PROTEIN RECA
    6e-17  18%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-17   9%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    1e-16  22%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-16   9%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    1e-16  13%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-16  10%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-16  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    3e-16  11%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    3e-16  11%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    3e-16  21%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-16  12%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    3e-16  10%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-16   9%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-16  12%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-16  12%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-16  12%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-16   6%  2c4rL  [x.x.x] RIBONUCLEASE E
    5e-16  15%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-16  10%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    6e-16  12%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-16  12%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-16   9%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    8e-16  13%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-16  10%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    8e-16  12%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-16  15%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-15  10%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15  10%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    1e-15  10%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    1e-15   9%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-15  10%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15  15%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    2e-15   9%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    2e-15  12%  3cmvE  [x.x.x] PROTEIN RECA
    2e-15   9%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    3e-15   8%  2c9oC  [x.x.x] RUVB-LIKE 1
    3e-15  11%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-15  12%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    4e-15  13%  2cckB  [x.x.x] THYMIDYLATE KINASE
    4e-15  10%  2c0bL  [x.x.x] RIBONUCLEASE E
    4e-15  11%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    5e-15  12%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    5e-15   7%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    6e-15  11%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    7e-15  14%  2b8tC  [x.x.x] THYMIDINE KINASE
    7e-15  11%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    8e-15  26%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-15  11%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    9e-15  10%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-14   8%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-14  11%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-14  26%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-14  13%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-14  10%  2bx2L  [x.x.x] RIBONUCLEASE E
    2e-14  23%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-14  10%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-14  11%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    3e-14  10%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-14  18%  2d2eA  [x.x.x] SUFC PROTEIN
    3e-14  12%  3cmwC  [x.x.x] PROTEIN RECA
    3e-14   9%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-14   8%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-14  13%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    3e-14  12%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    4e-14  19%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-14   7%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-14  10%  1adoA  [c.1.10] ALDOLASE
    7e-14  28%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    8e-14  12%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    9e-14  11%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    1e-13   8%  2bhvA  [x.x.x] COMB10
    1e-13  13%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    1e-13  12%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-13   6%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    1e-13   8%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-13  29%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-13  13%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-13  13%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-13   8%  3bczC  [x.x.x] PROTEIN MEMO1
    2e-13  26%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-13  12%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    2e-13  15%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-13  11%  1e2kA  [c.37.1] THYMIDINE KINASE
    2e-13  17%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    2e-13  16%  2a1fF  [x.x.x] URIDYLATE KINASE
    2e-13  12%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    3e-13   8%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    3e-13  11%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    5e-13  16%  3a00A  [x.x.x] GUANYLATE KINASE
    5e-13   9%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    5e-13  15%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    5e-13  17%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-13  15%  3cmuA  [x.x.x] PROTEIN RECA
    7e-13   8%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-13  16%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    1e-12  14%  1e2iB  [c.37.1] THYMIDINE KINASE
    1e-12   9%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    1e-12  12%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-12  10%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-12   8%  2bhvD  [x.x.x] COMB10
    1e-12  11%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-12   8%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    2e-12  13%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    2e-12  16%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-12  12%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-12  12%  3dlbB  [x.x.x] ARGONAUTE
    2e-12  16%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-12  11%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    3e-12  11%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-12  13%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-12   9%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    4e-12  14%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-12  12%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    4e-12   9%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    5e-12  21%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-12  10%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-12  11%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-12  10%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-11  13%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-11   9%  1e2hB  [c.37.1] THYMIDINE KINASE
    1e-11  11%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    2e-11  18%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-11  11%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-11  10%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-11   9%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    2e-11  12%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-11   9%  2dftA  [x.x.x] SHIKIMATE KINASE
    3e-11  11%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    4e-11  10%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    4e-11   9%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-11  11%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-11  10%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    6e-11  12%  3cmvB  [x.x.x] PROTEIN RECA
    7e-11   8%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-11  12%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    8e-11   7%  2c9gA  [x.x.x] PENTON PROTEIN
    9e-11  11%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    9e-11  23%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-10  14%  2ancF  [x.x.x] GUANYLATE KINASE
    1e-10  11%  2dftC  [x.x.x] SHIKIMATE KINASE
    1e-10   9%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    1e-10  10%  1e2iA  [c.37.1] THYMIDINE KINASE
    1e-10  10%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-10   9%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-10  13%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    1e-10  12%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-10   9%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-10  11%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    2e-10  11%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    2e-10  18%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  20%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-10  12%  3be4A  [x.x.x] ADENYLATE KINASE
    3e-10  13%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    3e-10  13%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    3e-10  13%  1e2jA  [c.37.1] THYMIDINE KINASE
    3e-10  10%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-10  14%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    4e-10  15%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    5e-10  11%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-10  11%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    5e-10   7%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    5e-10  14%  3a00B  [x.x.x] GUANYLATE KINASE
    5e-10  11%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-10  10%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    6e-10   8%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    6e-10  13%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    6e-10  11%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    7e-10  11%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    7e-10  12%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    7e-10  12%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    8e-10  10%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-09  15%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    1e-09  12%  1e2mA  [c.37.1] THYMIDINE KINASE
    1e-09  13%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-09   6%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    1e-09  11%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    2e-09  11%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-09   9%  1e2nA  [c.37.1] THYMIDINE KINASE
    2e-09  11%  1e2mB  [c.37.1] THYMIDINE KINASE
    2e-09   9%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-09   8%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-09  14%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-09  11%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-09  10%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    3e-09  12%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    4e-09  12%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    4e-09  31%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-09  10%  3bm2B  [x.x.x] PROTEIN YDJA
    4e-09  10%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-09  16%  2a1fE  [x.x.x] URIDYLATE KINASE
    5e-09   9%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    5e-09   5%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    5e-09  13%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-09  11%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    6e-09  11%  1e2lB  [c.37.1] THYMIDINE KINASE
    6e-09  16%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    7e-09  11%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    7e-09   9%  3dfdA  [x.x.x] PROTEIN YQBN
    9e-09  13%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-08  16%  2a1fD  [x.x.x] URIDYLATE KINASE
    2e-08  14%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    2e-08  12%  1e2lA  [c.37.1] THYMIDINE KINASE
    2e-08   9%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    3e-08   7%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    4e-08   7%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    4e-08  13%  1e2kB  [c.37.1] THYMIDINE KINASE
    4e-08  15%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    5e-08  12%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    6e-08   9%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-08  10%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    8e-08  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    8e-08  17%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-08   8%  2bhvC  [x.x.x] COMB10
    1e-07  11%  2b8tD  [x.x.x] THYMIDINE KINASE
    1e-07  10%  1e2nB  [c.37.1] THYMIDINE KINASE
    1e-07  14%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    2e-07  19%  1chdA  [x.x.x] CHEB METHYLESTERASE
    2e-07  12%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    3e-07  11%  2cdnA  [x.x.x] ADENYLATE KINASE
    4e-07  17%  3dkvA  [x.x.x] ADENYLATE KINASE
    5e-07   0%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    6e-07  28%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-07  15%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    8e-07  11%  2an9A  [x.x.x] GUANYLATE KINASE
    8e-07  30%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-06   9%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-06  16%  2a1fC  [x.x.x] URIDYLATE KINASE
    1e-06   8%  1eamA  [c.66.1] PROTEIN (VP39)
    2e-06   7%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    2e-06  12%  2anbA  [x.x.x] GUANYLATE KINASE
    3e-06  17%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-06  10%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    5e-06  16%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    5e-06   4%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    6e-06  15%  2c5mD  [x.x.x] CTP SYNTHASE
    6e-06  16%  2bsqE  [x.x.x] TRAFFICKING PROTEIN A
    1e-05  14%  1e2jB  [c.37.1] THYMIDINE KINASE
    2e-05  13%  2c95B  [x.x.x] ADENYLATE KINASE 1
    3e-05  16%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-05   4%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    3e-05  35%  2ancB  [x.x.x] GUANYLATE KINASE
    4e-05  18%  2bsqH  [x.x.x] TRAFFICKING PROTEIN A
    4e-05  23%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    4e-05   6%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    4e-05  24%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    6e-05  12%  1e2hA  [c.37.1] THYMIDINE KINASE
    1e-04  16%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    1e-04  13%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    2e-04  18%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    4e-04  18%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    4e-04  27%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    4e-04  17%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    4e-04  22%  2c9oB  [x.x.x] RUVB-LIKE 1
    5e-04  18%  1a2kD  [c.37.1] RAN
    7e-04  10%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    7e-04   6%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    0.001  14%  3c94A  [x.x.x] EXODEOXYRIBONUCLEASE I
    0.001  10%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
:210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSS
3b5jA           -ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIRFYIPENGQVLIDGHDLALADPN
2dwoA           -SRVQKIWVPVDHRPSL-PRSCGPNSPTVIVMVGLPARGKTYISKKLRYLNWIGVPTKVFNVGEYRREAV
2d3wB           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPE
3cmvH           -DRSMDVETISTGSLSLDLGAGGLPMGRIVEIYGPESSGKTTLTLQVAAAQREGKTCAFIDAEHALD---
3cmvG           ---VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVAAAQREGKTCAFIDAEHALDP--
3c95A           HPENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQATLRPEDADRLGINRQHCLDNLKI
2dwpA           -------------QSRVQKIWVPVNSPTVIVMVGLPARGKTYISKKLRYLNWIGVPTKVFNVGEYRREAV
3eiuA           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQSVPGSESAFAVVFAAMGITN
2bifA           --------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIVPTREFNVGQYRRDMV
2c61B           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIRQASVPGSESAFAVVFAAMGITN
1bifA           --------------------------PTLIVMVGLPARGKTYISKKLRYLNFIGVPTREFNVG-------
3dmdC           -KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVV-----------
1e69A           -------KLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGS
3cmvC           EDRSMDVETISTLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREKTCAFIDAEHALD---
3b60A           DLEFRNVTFTYPGREALRNINLKIPAGKTVALVGRSGSGKSTIASLIRFYDIDEGHILMDGHDLREYTLA
2czvA           -------------GGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEVDKEKLREARKEYGKVAILLSV
1d1cA           RRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLSVAGRNQAGVLEQQILQAN
2b8wA           MCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFLGSTVQSHTKGMWCVP
3eiuB           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIRQASVPGSESAFAVVFAAMGITN
3dmdB           VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVV-----------
2ccjB           ---------------------------AFITFEGPEGSGKTTVINEVHRLVKDYDVIMTREPGGVPTGEE
2akaB           MEDLIPLVNRLQDA-FSAIGQNADLDLPQIAVVGGQSAGKSSVLENFGRDFLPRGSGIVTRRPLVLQLVN
3cmvA           SMDVETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAQREGKTCAFIDAEHALD---
2ccgA           ---------------------------AFITFEGPEGSGKTTVINEVYHRLVKDDVIMTREPGGVPTGEE
3b2qA           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIT
2b8tA           --------------------------GWIEFITGPMFAGKTAELIRRLHRLYADVKYLVFKPKIDTR-SI
2bc9A           MCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLGKKKGFSLGSTVQSHTKGIWMWC
1e9fA           --------------------------GALIVLEGVDGAGKSTQSRKLVEALAAGHRAELLRFPERSTE--
3cr7C           ------------------------QRGLTIWLTGLSASGKSTLAVELHQLVRDRRVHAYRLDGDNIRFGL
2bbsA           -EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQN
2c03B           -VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLLYYKGKGRRPLLVAADTQRPAAR
2ccgB           --------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDDVIMTREPGGVPTG--
1aroP           ----------------------------------------------------------------------
3czpB           DAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVDALDPRQYHIVPIAAPTEEERAQ
2ctsA           -------ASSTNLKDILADLIPKERIKTFRQQHGNTAVGQITVDMMYGMRGMKGLVYETSVLDPDEGIRF
2axpA           ----------------------------LIILEGPDCCFKSTVAAKLKELKYPIIKGSSFELAKSGNEKL
2a2zD           --------------------------IKKISIEGNIAAGKSTFVNILQLCEDWEVVPEPVARWCNVQQMM
2dr3A           ---------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFWNGLKMGEPGIYVALEEHPVQ-V
2awnD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
3b85A           ----------RPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAQALQSKQVSRIILTRPAVEAGEK
3cddD           ------IVLKAGGKIYQGWTKIGITRSDLETYKFNDAQYKAFIEPIKQGQADIGGERVITGYVDDWVPSY
2cgtH           DKSFGAPTITKDGVSVAREIELEKFENMGAQMVKEVASKANDAADGTTTATVLAQAIITEGLKAVAAGMN
3cddC           ------------------------------KAGGKIYQGWTKIGITRSLEASGAFDLETYKFQKQGQACT
1e98A           ------------------------RRGALIVLEGVDRAGKSTQSRKLVEALAAGHRAELLRFPERSTEIG
4dcgA           -ESANEVAKKLPYQELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLDHFYNLGVIIKWMLIDGRHHDPI
1e9cA           --------------------------GALIVLEGVDRAGKSTQSRKLEALCAAGHRAELLRFPERSTEI-
2d62A           -VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEKG
3d3kA           --------------------KHGLTLERRLEMTGVCASQMALTLLGGPQRPTVAGPHVKGAQGISCGRHL
2c61A           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIAQASVPGSESAFAVVFAAMGITN
3d7wA           -DYVSSGSFSNN-IPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVAYEAGNQSYFLSDAPA
3bpbA           -IIARTPARSLVDSSHLGKPDYAKALEQHNAYIRALQVDITLLPPDERFPDEDPVLCTSRCAIITRPGAE
2ausC           ----------------------------------------------------------------------
3a1wA           ------------------------------ALAGCPNVGKTSLFNALGTKQYVANWPGVTVEKKEGVFTY
3cr7A           --------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG
1e2dA           --------------------------GALIVLEGVDRAGKSTQSRKLEALCAAGHRAELLRFPERST---
2cjwB           ---------------------FGMTYYRV-VLIGEQGVGKSTLANIFGVEDTYERTLMVDGESATIILLD
1e9rA           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELYTGLLRGDRMVIVDPNGDMLSKF
1cr4A           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEE
3dm5A           -EHIIKIVYEEKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLRYFQKRGYKVGVVCSDTWRPGAY
2c03A           -VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLLYYKGKGRRPLLVAADTQRPAAR
2d4uA           -------------------------------PLGSGGLFFNALKNCKENFTVLQIRQQQSTLNGSWVALL
2awnC           -------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRM------------------------
3b2qB           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIT
1e9sG           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELYTGLLRGDRMVIVDPNGDML---
2eg5G           -YNQLVLAKVKCVRELLRANLPNINKCIKVADLGCASGPNTLLTQSIDKVGQLERPTIQIFLNDLFPNDF
2dr3E           ---------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFWNGLKMGEPGIYVALEEHPV-QV
1e0jB           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAGKKVGLAMLEESV---
3adkA           -------------------MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTLSTGDLLRAEVSSGSA
3cr7D           ------------------------QRGLTIWLTGLSASGKSTLAVEEHQLVRDRRVHAYRLDGDNIRFGE
2a5gA           ------------------------------LMLGLDAAGKTTILYKLLGQSVTTIPTVGFNVETVTYKNV
3dhwC           MIKLSNITKVFHQGTALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLRPTEGSVLVDGQELTTLSES
2a30B           --------------------------IKKISIEGNIAAGKSTFVNILWEVVPEPVARWCNVQSTNVLQMM
2akaA           RRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVQYLASVAGRNQANGSGVLEQQIL
2bdtA           ---------------------------KLYIITGPAGVGKSTTCKRLAQLDNSAYIEGDIINHVVGGYRP
2cckA           ---------------------------AFITFEGPEGSGKTTVINEVHRLVKDYDVIMTREPGGVPTGEE
3cm0A           --------------------------GQAVIFLGPPGAGKGTQASRLQELGFKKLSTGDILRD--HVARG
1bg0A           --SIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDD----YHGGFKLTDKHPP
3czpA           DAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVDALDPRQYHIVPIAAPTEEERAQ
1e9dA           ------------------------RRGALIVLEGVDRAGKSTQSRKLEALCAAGHRAELLRFPERSTEIG
3bh0A           -SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDVVNLHSLEMGKKENI
2a2zA           --------------------------IKKISIEGNIAAGKSTFVNILQLCEDWEVVPEPVARWCNVQS--
2a30D           --------------------------IKKISIEGNIAAGKSTFVNILQLCEDWEVVPEPVAQSTNVLQMM
421pA           ------------------------------VVVGARGVGKSALTIQLIQNHVDEYDPTIEDSYRKQVVID
2c9yA           --------------------------GIRAVLLGPPGAGKGTQAPLAENFCVCHLATGDMLRAM--VASG
1e4yA           ------------------------------ILLGALVAGKGTQAQFIEKYGIPQISTGDMLRAAVKSGSE
2bofX           -------------------------------------------------VNPNMSSAEWVRNNPNDP---
3bo6B           -HSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFLESHGGDVFMHAHRENPQCKGDFAGDKFHI
2axzC           -----------------------------------------------------------------IEPKR
2c04A           -VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYKGKGRRPLLVAADTQRPAAR
2cvfA           ---------STGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGG--FSPER
1e0jA           -HLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQLQWGTAMGKKVGLAMLEESVEET
2bkhA           -SLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESGTGQDIDDRI-----V
2awnB           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIGLETITSGDLFIGEKRMNDTPPA
3c8uA           -------TLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEV---------V
3cmtD           --DVETISTGSLSLDIALGA-GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREKTCAFIDAEH---ALD
1dkiA           LLDSKGIHYNQGNPYLLTPVIEKVKPGEQSGQHAATGSVATATAQIMKYHNPNKGLKDYTYTLSSNN---
3dt2A           ALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
3bb1B           -SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVSRS
2d4hB           MCLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLCVPHPKKPGHILVLLDTEGLGQN
3da4A           -VLHPGISVYDAYHF---AKPAPSQYDYRSMNMKQMSGNVTTPIVALHYLWGNGAERSVNIANIGLKQIK
2b8tB           --------------------------GWIEFITGPMFAGKTAELIRRLHRLYADVKYLVFKPKILPSVEV
3dtbB           ASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVEVGDDIAWMKFDAQG
1e9sF           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELYTGLLRGDRMVIVDPNGDMLSKF
3dt4A           ALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
1e6cA           ---------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDFMQHTSGMADV
2bkiA           KSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLYLTESYGTGQDIDDRIVEANPL
3clvA           ---------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTHENTNTTIGASFCTNYNEN
2b92B           MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNLAGKKKGFSLGSTVQSHTKGIWMWC
3dffA           ---------------------------------------------LAISPHLDDAVLSF-GAGLAQ-AAQ
3dfqA           ----------------------------------------------------------------------
3cmxA           SMDVETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVAAAQREGKTCAFIDAEH---ALD
3bb1A           -SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIGERVVSISPFQSEGPRPVMVSRS
2bhjA           --------------------------------------------------NWGSGEILHDTLHHKATLGS
2bbsB           ---TEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGRISFCSQNS
1e2fA           ------------------------RRGALIVLEGVDRAGKSTQSRLVEALCAAGHRAELLRFPERSTEIG
1e9rE           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP--NGDML
3cddF           -GYVDDWVPESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCPFGIKVIVNTDVGEPFQRI
1e3mA           ------------EKQLYEELFDLLLPH-LEALQQSALVNLAERAYTLYTCPTFIDKPGIRITEGRHP--V
1cjaA           ----------SFRVITTLANQANILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDVIVNNSDR
2ahvA           ---VKPPRINGRVPVLAQEAVNYIPDEATLCVLGGILEATTLITALADKYKPTGLGDRADRGISPLAQEG
2d3wC           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTVEFKGKDLLALSPE
1dg3A           MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPGHI
2czvB           ------VKFIEMDIRDKEAYELAKEWFEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTV
1e9sD           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKVLLRELAYTGLLRGDRMVIVDPNGDMLSKF
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2c4rL           ---------------------IELKEALASLELPEGMGLIVRTAGVGKSAALQWDLSFRLKHWEAIKKAA
3dt4C           ALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLGWKVECVGDDIAWMKFDAQG
1cr1A           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEE
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2ahwD           ---VKPPRINGRVPVLAQEAVNYIPDEATLCVLGGILEATTLITALADKYKPTGLGDRADRGISPLA-QE
1d6jB           ----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELHQLVRDRRAYRLDGDNIRFGLNK
2a2zB           --------------------------IKKISIEGNIAAGKSTFVNILQLCEDWEVVPEPVARWCNVQSTN
3bb1E           -SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
3dt7A           ALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
3dfnA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a30A           --------------------------IKKISIEGNIAAGKSTFVNILQLCEDWEVVPEPVARWCNVQSTN
2d0kA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
3ch4B           -----------------SMAPLGGAPRLVLLFSGKRKSGKDFVEALQSRLGADVCAVLRLSGPLKEQYAQ
3cmvE           EDRSMDVETISTGSLSLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKCAFIDAEHALDP--
2a5jA           -----------------SGLVPRGSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDGKQ
2c9oC           -QAASGLVGQEACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEI
1e9sJ           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLS--
6aldA           ----------------------------------------------------------------------
2cckB           ---------------------------AFITFEGPEGSGKTTVINEVYHRLVKDDVIMTREPGGVPTGEE
2c0bL           ---------------------------------ASLELPLIVRTAGVGKSAEALQWDLSFRLKHWEAIKK
1av6A           -PESANEVAKKLPYELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRD--HFYNLGVIIKWMLIDGRHH
1dekB           ---------------------------KLIFLSGVKRSGKDTTADFISNYSAVKYQL------------A
3bgwA           ------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVNLHSLEMGKKENI
2dr3B           ---------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGKMGEPGIYVALEEHPVQVR
2b8tC           --------------------------GWIEFITGPMFAGKTAELIRRHRLEYADVKYLVFKPKIDSRTGT
2bwjA           --------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLEKYGFTHLSTGELLRE--ELASE
2awnA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIGLETITSGDLFIGEKRMNDTPPA
2d4hA           MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKYLMNKLAGKKKGFSLGSTVQKGIWMWCVPH
1dhjA           ----------------------------------------------------------------------
1ai4B           --------------------TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWWNNSPQKD
1bmfC           IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFDGTDEKKKLYCIYVAI
2awoC           -------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITGDLFIGEKRMNDTPPA
1e3mB           ------------------------------------LVNLAERAYTLNYTCPTFIDK--PGIRITEGR--
2bx2L           ----------------------------------------------------------------------
2d3wD           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKLLALSPE
3dfnD           ----------------------------------------------------------------------
1e59A           ------------------------RHGESQWNKENRFTGWYDVDLSEGVSEAKAAGKLLKEEGYSFDFAY
3dfpC           ----------------------------------------------------------------------
2d2eA           QLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEIDGENILELSP
3cmwC           ---------STGSLSLDILGAGGLPMGRIVEIYGPESSGKTTLTLQVAAAQREGKTCAFIDAEH---ALD
1e9sB           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTLLRGDRMVIVDPNGDMLSKF
1dhiA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2dflA           KERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNQLPPEKGGLSGKAVYIDTEG
2bbtB           -ELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQN
1e9sM           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRDRMVIVDPNGDMLSKF
1adoA           ----------------------------------------------------------------------
3d31A           MIEIESLSRKWKNF-SLDNLSLKVESGEYFVILGPTGAGKTLFLELIGFHVPDSGRILLDGKDVTDLSPE
2dr3F           ---------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQLWNGLKMGEPGIYVALE-EHPVQV
1e3aB           -----------TQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSHDPRLPVPGTGKWDWKGLLPFEMN
2bhvA           ----------------------------------------------------------------------
1accA           ---------QETTARIIFNGKDLNLVERRIAAVNPSTTKPDMALKIAFGFNEPNGNLQYQGKDITEF---
3crmA           --------------------------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMDIG
3czjA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1b0uA           KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSGAIIVNGQNVADKNQL
3cr7B           --------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVLDGDNIRFGLNKD
3d3qB           --------------------------PFLIVIVGPTASGKTELSIVAKKFNGEIISGDSQVYQGDIGTAK
3bczC           --------------------------WYTASGPQLNAQLEGWLSQVQSTKPARAIIAPHAGYT-YCGSCA
2awoA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLRMIAGLETITSGDLFIGEKRMNDTPPA
3bjdB           ----------------------------------------------------------------------
3bb1C           -SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
1e2kA           ------------------------PTLLRVYIDGPHGMGKTTTTQLLADDIVYVPEPMTYWRVLGAS---
1cfrA           ------------------------------DIISKSGEGNKYTINSASGLRDFDEAIRLGGKGSFNKCNG
2a1fF           ----------------------------------------------------------------------
1cr2A           -SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQLQWGTAMGKKVGLAM---LEESV
3bgwD           ESADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQKNMSDNDDVVNLHSLEMGKKENI
1d6jA           ----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVR-----DRRVHAYRLDGD
3a00A           ---------------------------RPIVISGPSGTGKSTLLKKLFAEYDSFGFSVSSTTRTPRAGEV
3cbnA           ------------------------------------------------------YTLRARGHPNV-----
2aunB           ----------------------------------------------------------------------
3bb1F           -SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
3cmuA           ---------STGSLSLDILGAGGLPMGRIVEIYGPESSGKTTLTLQVAAAQREGKTCAFIDAEH---ALD
1e9sH           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELYTGLLRGDRMVIVDPNGDML---
2d7vB           -AALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVFSGTSKPTLQQLEKHH--
1e2iB           --------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY------------
1e2gA           --------------------------GALIVLEGVDRAGKSTQSRLVEALCAAGHRAELLRFPERSTEIG
1e9sI           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1e9rF           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELYTGLLRGDRMVIVDPNGDML--S
2bhvD           ----------------------------------------------------------------------
3cnlA           KQGKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKAKGIQWFSLENGVKILDTPG
3dauA           ----------------------------------------------------------------------
2dr3C           ---------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTISQQFLWNGLKMGEPGIYVALEEHPVQVR
2d7vA           VAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVFSGTSKPTLQQLEKHH--
2aumB           ----------------------------------------------------------------------
3dlbB           ----------------------WVEGLAVYRREHARGPGWRVLGGAV------------------LDLWV
1cjtC           -------------------------ATHRLLLLGAGESGKSTIVKQMILHVGEKATKVQDIKNNLKEAIE
2bjbA           LQTLGLRVDGVGSELTVSGRIEPGPGARVD--CGLAG----TVLRFVPPLALGSVPVTFDGDQARGRPIA
1e9rD           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
3d3qA           --------------------------PFLIVIVGPTASGKTELSIEVKKFNGEIISGDSQVYQGDTEEEG
3b55A           ----------------------------------------------------------------------
1cs4C           -------------------------ATHRLLLLGAGESGKSTIVKQMILHVGEKATKVQDIKNNLKEAIE
2dpyB           PLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMRYTRADVIVVGLIGERGVKDFIE
2ck3C           IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINKRFNDGTDEKKKLYCIY-VA
2d3wA           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGLALSPEDRAGEG
3dfqC           ----------------------------------------------------------------------
1e9sL           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELYTGLLRGDRMVIVDPNGDMLSKF
3dfoC           ----------------------------------------------------------------------
3cioD           ------------LRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAVIAQSDQKVLFIDADLRRGYSH
1e2hB           ------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPASETIANIYT
3dymA           ----------------------------------------------------------------------
1culC           -------------------------ATHRLLLLGAGESGKSTIVKQMILHVGEKATKVQDIKNNLKE-AI
1e9rG           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELYTGLLRGDRMVIVDPNGDMLSKF
1bglA           ----------------------------------------------------------------------
1cr0A           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGAMGKKVGLAMLEESVEET
2aumA           ----------------------------------------------------------------------
2dftA           ---------------------------PKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSI
2a5vA           MFVVRTAGHVIDSAVLGSEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGYVRDVVERV------
3di4A           -----------VLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNLH----NLHDLTERFFSGKTRAL--H
1e9sE           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTLLRGDRMVIVDPNGDMLSKF
3dm9B           -VKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLNWLKNHGFSVVIAASDTFRAGAI
2b8wB           MCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKYLMNKLAGKKKGFSLGSTVQSHTKGIWMWC
3cmvB           EDRSMDVETISTGSLSLDLGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA--EHALD
1draA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2c9gA           VMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLESDIG---------
2a5vB           MFVVRTAGHVIDSAVLGSEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGY--VRDVVER----
3bk7A           ---------------------GEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVE-------WDLT
2ancF           --------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGIDW
2dftC           ---------------------------PKAVLVGLPGSGKSTIGRRLAKALGVGLLTDVAIEQRTGRSIA
3cueF           -----------------------YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKLDGKTVKL
1e2iA           ------------------------PTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLG----ASETIANI
1dekA           ---------------------------KLIFLSGVKRSGKDTTADFISNYSAVKYQLAGPIKDALAYAWG
2drcA           ----------------------------------------------------------------------
4atjA           -----------------------------------------------------DPRIAASILRLHFEDCF
3e8aC           -------------------------ATHRLLLLGAGESGKSTIVKQMILHVNGEKATKVQDIKNNLK---
5dfrA           ----------------------------------------------------------------------
2bv7A           ---LGSPVFTPIKADISGNI------TKIKAVYDTNPTKFRTLQNILEVEKEMYG-----AEWPKVGATL
1dw9A           -QINRNIRLDLADALSKAKKDLSFAE-----IADGTGLAEAFVTAALGQQALPADAARLVGAKLDLDEDS
2bbtA           -EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQN
2d2fA           QLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVEILLDGENILELSPD
3be4A           ------------------------SKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDLREAIKNGIG
2e85B           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1e2jA           --------------------------LLRVYIDGPHGMGKTTTTQLLRDDEPMTYWRVLGASETIANIYT
4dfrA           ----------------------------------------------------------------------
3c15C           -----------------------YRATHRLLLLGAGESGKSTIVKQMRILHNGEKATKVQDIKKEAIETI
3c14C           -------------------------ATHRLLLLGAGESGKSTIVKQMRILVNGEKATKVQDIKNNLKEAI
3bv4A           ----------------------------------------------------------------------
1ek0A           ------------------------------VLLGEAAVGKSSIVLRFVSNDAENKEPTIGAAFLTQRVTI
2c7cH           ----------------------------------------------------------------------
3a00B           ---------------------------RPIVISGPSGTGKSTLLKKFAEYPDSFGFSVSSTTRTPRAGEV
3bb1H           -SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGEVVSISPFQSEGPRPVMVSRS
1c9kC           ----------------------------MILVTGGARSGKSRHAEALIGDAPQVLYIATS----QILHHK
1e1qB           -IPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQRFNDGTDEKKKLYCIYVAI
3d1mB           ----------------------------------------------------------------------
1ckvA           -AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILTDYKKNVNPTVNVEDRAGYWWI
2bkeA           VKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTE
2dr3D           ---------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQV
2dpyA           PLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYRADVIVVGLIGERGVKDFIE
1akeA           -----------------------------IILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLR-AAVKSG
3ecpA           ----------------------------------------------------------------------
1e2mA           --------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGA---S
3bb1D           -SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
3dyoA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3bb1G           -SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEVMVSRSRAG
1e2nA           --------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDYVPEPMTYWRVLGAS
1e2mB           --------------------------LLRVYIDGPHGMGKTTTTQLLVALEPMTYWRVLGASETIANIYT
1ak2A           --------------------------GVRAVLLGPPGAGKGTAPKLAKNFCVCHLATGDMLRAMVASGSE
1dyhA           ----------------------------------------------------------------------
1cjuC           -------------------------ATHRLLLLGAGESGKSTIVKQMILHVNGEKATKVQDIKKEAIETI
3cddA           ------------------------ASGAFDLETYKFLGNDAQYKAIEPIKQGQACTVDIGGERVITGYVD
3c7kC           ---------------------------KL-LLLGAGESGKSTIVKQMKIIHEDGFSGED-----------
3ed8A           -IELKGTDFK-EDGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFVRHNVEDGSVQLADHYQQNTP--
3do6A           -LYPYGHYIAKIDHRFLKSLENHEDGKLILVTATPAGEGKTTSIGLSSLNRIGKKSI-------------
2awoD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRM------------------------
3bm2B           ----------------------------------------------------------------------
1e9sA           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLREAYTGLLRGDRMVIVDPNGDMLSKF
2a1fE           ----------------------------------------------------------------------
3dvlD           --EHQAIAKRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSQFLYNGIIEFDEPGVFVTFEETPQDI
3brwA           -LECNPTARIFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVI-----------
3cnnA           ----------KGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLGKRAGIQWFSLENGVKILDTPGI
3bwdD           --------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFANVVLGLWDTAGEDYN
1e2lB           --------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY--VPEPMTYWRV
1d8jA           ----------------------------------------------------------------------
1dvrA           --------------------------SIRMVLIGPPGAGKGTQAPNLQERFHAA-HLATGDMLRSQIAKG
3dfdA           -IDAEEVEVPISKRFNVVPFIFKAITTDRIDELEKENTTKELDSQR------FYARIAVETTVYPTFKAK
2e85A           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3b9qA           IKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFRAAA
1e2lA           --------------------------LLRVYIDGPHGMGKTTTTQLLIVYVPEPMTYWRVLGASETIANI
3b85B           ----------------------AIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGE
1dp0A           ----------------------------------------------------------------------
1afrA           -------------REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLPVEKCWQPQDFLPDPASDGFDEQ
1e2kB           --------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMT---YWR
3c7kA           ------------------------------LLLGAGESGKSTIVKQMKIIFGEDVKQYKPVVYSNTIQSL
3c85A           --------------------------------------------------NPGHAQVLILGGRIGTG-AY
1drbA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2ccjA           ---------------------------AFITFEGPEGSGKTTVINEVYHRVKDYDVIMTR---------E
1e9rB           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMV-----------
2bhvC           ----------------------------------------------------------------------
2b8tD           --------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKSIRNIQ
1e2nB           --------------------------LLRVYIDGPHGMGKTTTTQLLVALEPMTYWRVLGASETIANIYT
1azsC           -----------------------YRATHRLLLLGAGESGKSTIVKQMRILVNGEKATKVQDIKNNLKEAI
1chdA           ----------------------------------------------------------------------
3cphA           ------------------------------LLIGDSGVGKSCLLVRFVEDKFNPGIDFKIKTVDINGKKV
2cdnA           -------------------------SHMRVLLLGPPGAGKGTQAVKLAEKLGIGELFRRNIEEGTKLGVE
3dkvA           ------------------------------VLMGLPGAGKGTQAERIVE-KYGIPHISTGDMFRAAMKEE
2aexA           ----------------------------------------------------------------------
2bboA           EVVMENVTAFWEEGLVLKDINFKIERGQLLAVAGSTGAGKTSLLMM------------------------
1cjvC           -------------------------ATHRLLLLGAGESGKSTIVKQMRILVEKATKVQDIKNNLKEAIET
2an9A           --------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPG
2ancD           --------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVS-----------
1e4vA           -----------------------------IILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGS
2a1fC           ----------------------------------------------------------------------
1eamA           --------KKLPYQELFFLSKLQRHGILDGATVVYIGSAPGTHIRYRDHFYNLGVIIKWMLIDGRHHDPI
3bjqB           ----------------------------------------------------------------------
2anbA           --------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVS----VSHTTRQ
1e9sK           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMV-----------
3bs4A           ---------SWEIEELDREIGKIKKHSLILIHEEDASSRGKDILYILSRKLKSDNLVGMFSISYP-LQLI
2axnA           -SRVQKIWVPVDHRPS-LPRSCGPNSPTVIVMVGLPARGKTYISKK------------------------
3cqcA           LKQGNAIMRKFKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHL------------------------
2c5mD           ----------------------------------------------------------------------
2bsqE           ----------------------------------------------------------------------
1e2jB           --------------------------LLRVYIDGPHGMGKTTTTQLLALGSRDDIVYVPEPMTYWRVLGA
2c95B           ---------------------EKLKKTNIIFVVGGPGSGKGTQCEKI--VQKYGYTHLSTGDLLRSEVSS
3dmdA           -KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGA
1d2zD           FPAEIKKGFKYTAQDQIDEAANRLPPDQSKSQTSGKLNERPTVGVLLQLLVQAEADFVALDFLNEPARPV
2ancB           --------------------------GTLYIVSAPSGAGKSSLIQA------------------------
2bsqH           ----------------------------------------------------------------------
2a78A           ------------------------------IMVGSGGVGKSALTLQFMYDEFVEDYEPTKA---------
1d6aA           VKSRSQVQLGIQILDKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQVKTNFNRAFNPNKVLNLQE
2bwjB           --------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFT----------------
1e2hA           --------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRV---LGAS
1agpA           ------------------------------VVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVI
3cbqA           ------------------------------MLVGESGVGKSTLAGTFGGLQGDSAHPENPEDTYERRIMV
2cbzA           -ITVRNATFTWADPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSA------------------------
1ckeA           --------------------------APVITIDGPSGAGKGTLCKAMQWHLLDSGAIYHHHVDVASEDAL
2bwjD           ------------------------RKCKIIFIIGGPGSGKGTQCEKLVEKYGFT----------------
2ax4B           --------------------------GCTVWLTGLSGAGKTTISFALEEYSHAIPCYSLDGDNVRHGFSP
2c9oB           -------------GVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFC------------
1a2kD           ------------------------------VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFH
3ci2A           ----------------------------------------------------------------------
3cddE           ------------------------IYQGWTKIGITRSLEASGAFDLEYKFLGNYKAFIEPIK--QGQACT
3c94A           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES
3b5jA           WLRRQVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTI-VGEQGAGLSGGQR
2dwoA           K--QYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGG----------------QIAVFDATNTTR
2d3wB           DRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLRSVNVGFSGGEK
3cmvH           PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAAEIEGEIG-DSHMGLAARMMSQA
3cmvG           -IYARKLGVDIDNLLCSQPDTGEQALEICD---ALARSGDSVAALTPKAEIEGEIGDSHMGLAARMMSQA
3c95A           LRENPQVAQLYNGFFSDADRAAMKIVL---ETEPRNLPALDITFVDKRIEKLLFNYRARNFPGTLDYAEQ
2dwpA           KQYSSYNFFRPDNEEAMK-----------------VRKQCALAALRDVKSYLAKEG-GQIAVFDATNTTR
3eiuA           EEAQYFMSDFEKTGALERAVVFLNLAHVLVILTDITNYAEALRQMGPGYMYTDLAT-LYERAGIVKGAKG
2bifA           KTYKSFEFFLPDNEEGLKI-----------------RKQCALAALNDVRKFLSEEG-GHVAVFDATNTTR
2c61B           EEAQYFMSDFEKTGALERAVVFLNLAVLVILTDITNYAEALRQMGYPGYMYTDL-ATLYERAGIVKGAKG
1bifA           ----------QYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEG-GHVAVFDATNTTR
3dmdC           ------IAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARG-IDVVLIDTAGRSE
1e69A           AYVELVFEENGEEITVARELKVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGR-RDQKLSLLSGGEK
3cmvC           PIYARKLGVDIDNLLCSQPDTGEQALEICDALAR-SGAVDVIVVDSVAALTPKAEI-EGLAARMMSQAMR
3b60A           SLRNQVALVSQNVHLFNNNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTII-GENGVLLSGGQR
2czvA           QKFKSYLIYVESNDLRVIRYSIEKGVDAIIPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYER
1d1cA           PILEANAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNY--HIFYQLLAGAT
2b8wA           HPKKPGHILVLLDTEGLGDVEKGDNQNDSWVYNSIGTINQQAMDQLYYVTELTHRI-RSKSVSFFPDFVW
3eiuB           EEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPALRQMGAAGYPGYMYTDLATLYERAGIVKGAKG
3dmdB           ------IAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKAR-GIDVVLIDTAGRSE
2ccjB           I--RKIVLEGNDMDIRTEAMLFAASRREHL--------VLKVIPALKEGKVVLCDRYIDSSLAYQGYARG
2akaB           STTEYAEFLHCKGKKFTDFEEVRLEINKGISPVPINLRVYSPHVLNLTLVDLPG-MTKVPVGDQPPDIEF
3cmvA           PIYARKLGVDIDNLLCSQPDTGEQALEIC----------DALARSGAVDVISVAALTAEIGLAARMMSQA
2ccgA           IRKIVLEGNDMDIRTEAM------------LFAASRREHLVLKVIPALKEGKVVLCDIDSSLAYQGYARG
3b2qA           NEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEAL
2b8tA           RNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETRICEVANILAENGFVVIIS-GLDKNFKGEPFGPIA
2bc9A           VPHPKKPGHILVLL---------------DTEGLGDVEKGDNQNDSWIFALAVLLS-STFVYNSIGTINQ
1e9fA           --IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFS-GVAFTGAKENFSLD
3cr7C           NGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPYVDKGLYKKAREGVIK
2bbsA           SWIMPGTIKENIIGVSYDEYRYRSV---------------IKACQLEEDISKFAEK-DNIVLITLSGGQR
2c03B           EQLRLLGEKVGVPV------------------LEVMDGESPESIRRRVEEKARLEAR-DLILVDTAGRLQ
2ccgB           ---EEIRKIVLEGNDMDIRTEAMLFAASRREHLV----LKVIPALKEGKVVLCDRY-IDSSLAYQGYARG
1aroP           --------------------NDFSDIELAAIP--FNTLADHYGERLAREQLALEHESYEMGEARFRKMFE
3czpB           PYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGKFWLAIDKQTQ
2ctsA           RYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTSWLSKEWAKRAALPSHVVTM-LDNFPTNLHPMSQ
2axpA           FNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHKRLRVRGDEYIEGKDI
2a2zD           YEKPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYES-ECMNETEWTIYQDWHD
2dr3A           RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEY----------------------EKYIVHDLTDIREF
2awnD           AERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRV
3b85A           LGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTPAQKFLTRLGFG
3cddD           D--ESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIA---DIVCKPFGIKVIVEPFQRIQIEQGET
2cgtH           PCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEG-MQFDRGYLSPYFI
3cddC           VDIGGERVITGYVDDWVPSYDESTICSIDYPSGQFNNQTLTQIADIVCKPFGIKVIGEPFQRIQIEQGET
1e98A           KLLSS----YLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFS-GVAFTGAKENFSLD
4dcgA           LNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRVMISILNPVASSLKWRCPFQWIKDFYIPHGNK
1e9cA           ---GKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSG-VAYTGAKENFSLD
2d62A           VFVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQEIDKRVREVAELGLTELL-NRKPRELSGGQR
3d3kA           ANHDVQVILFLPNFVKMLESITNELSLFSKTQGQ--QVSSLKDLPTSPVDLVINCL-DCPENVFLRDQPW
2c61A           EEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMH--VLVILTDITNYAEA
3d7wA           GAETQDFSGTTSSSQPFNGSYPDLE-----------------RYAGHRDQIPLGIDQLIQSVTALRFPGG
3bpbA           SRRGETEIIEETVQRFYPGKVERIEAPGTV-------EAGDIMMVGDHFYIGESAR-TNAEGARQMIAIL
2ausC           ----------------IKREVIVKDDKAE----TNPKWGFPPDKRPIELHIQYGVINLDKPPGPTSHEVV
3a1wA           KTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEIL-EMEKKVILAMTAI
3cr7A           LGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPYVDKGLYKKAREGVIK
1e2dA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVA-FTGAKENFSLDW
2cjwB           MWENH-DHMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNK-SDLVRREVSVSEGRA
1e9rA           GRDKD---IILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETA-KKLAL
1cr4A           TAEDLIGLHNRVRLRQSDSLKREII--------------ENGKFDQWFDELFGNDFHLYDSFAEAETDRL
3dm5A           HQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFK-------------------SKGVDIIIVDTAGRHK
2c03A           EQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLE-------------------ARDLILVDTAGRLQ
2d4uA           QLNRAGIRYMMDQNNIGSGSTVAELMESALKQAEKNWADYEALPRDPRQSTA-AAAEIKRNYDIYHNALA
2awnC           -IAGLGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
3b2qB           NEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTALRQMGRGYPGYMYTDLAT-LYERAGIVKGAKG
1e9sG           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTP
2eg5G           NSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQGTNKGSIYSSKA
2dr3E           RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEY----------------------EKYIVHDLTDIREF
1e0jB           ---EETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFA-EAETDRLLAKLAYM
3adkA           RGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFER-KIGQPTLLLYVDAG
3cr7D           ADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEV--AEETGLVYVDKGLYKKAREGVIK
2a5gA           KFNVWKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAII-LIFANKQDLPDAMKP
3dhwC           ELTKARRQIGFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDK-HDSYPSNLSGGQK
2a30B           YEKPERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRIFASNLYESECMNETEWTIYQDWHD
2akaA           QANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETHIFYQLLAGATA
2bdtA           PWESDEITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWT-NREELLRRDALRKK
2cckA           IRKIVLEDMDIRTEAMLFAASRREHLV---------------LKVIPALKEGKVVL-CDRYIDSSLAYQG
3cm0A           TPLGERVRPIMERGDLVPDDLIEELAERVIFDGFPRTLAQAEALDRLLSETGTRLLGV--VLVEVPEEEL
1bg0A           KQWGDINTLVGLDPAGQFIISTRVRCGRSLCLTAEQYKEMEEKVSSTLSSMEDELKGTYYPLTGMSKATQ
3czpA           PYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGKFWLAIDKQTQ
1e9dA           KLLSSY----LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSG-VAYTGAKENFSLD
3bh0A           KRLI------VTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQ-SVNYIWSKTRQTK
2a2zA           ---TNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRYIFASNLYESECMNE
2a30D           YEKPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYE-SECMNETEWTIYQDWHD
421pA           GETCLAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDV-PMVLVGNKCDLAA
2c9yA           SELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKLDSVIEFSIP
1e4yA           LGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRN-----------------------GFLLDGFPRTIP
2bofX           -----RTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGAPSHSAYR
3bo6B           SVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDQENSQYSASSLHNTR
2axzC           LTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNL-LNVLPYEEVSSII
2c04A           EQLRLLGEKVGVPV-------------------LEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQ
2cvfA           LVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVRSGLIAELSRQLQVLLWIARKH
1e0jA           AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFA-------EAETDRLLAKLAYM
2bkhA           EANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYRLCAGASE
2awnB           ERGVG---MVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLL-DRKPKALSGGQR
3c8uA           PDGFHLDNRLLEPRGLLPRKGAPETFDFEG--------FQRLCHALKHQERVIYPLFDRARDIAIAGA-A
3cmtD           PIYARKLGVDIDNLLCSQPDTGEQALEICDVAALTPKAEMGLAARMMSQAMRKLSNTLLIFINQIRMKNP
1dkiA           -PYFNHPKNLFAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGISV---DMDYGPSSGSAGSSRV
3dt2A           GNLRAINPE-NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEAPGVTITSWKNKEW
3bb1B           RAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLRLDAYRVDNLDKLVAKAITDSFGKGIWNK
2d4hB           DSWIFALSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLDFSLDLEADGQPL
3da4A           DIIKSGVVGTFPVSTKFTHATGDYNVITGAYLGNITLKTEGTLTISANGSWTYNGVSLTRLGAMFSGKEY
2b8tB           ESAPEILNYIMSNSFNDETKVIGIDEV---QFFDDRICEVANILAENGFVVIISGL-DKNFKGEPFGPIA
3dtbB           NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEW
1e9sF           GRDKD-IILNPYDQ-RTKGWSFFNEIRNDYD---------------------WQRYALSVVPRGKTDEAE
3dt4A           GNLRA-INPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVEGIDEPLAPGVTITSWKNKEW
1e6cA           VAAEGWPGFRRRESEALQAVATPNRVVATGGMVLLEQNRQFMRAHGTVVYLFAPAEESLQAHQRPTLTGR
2bkiA           LEAFG-----NAKTVRNNNSSRFGKFVEIHFNEKSSVVGHYLLEKSRICVQGKEERNYHIFYRLCAGASE
3clvA           LCIKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNYIIILVANKIDKN
2b92B           VVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSFVSFFP
3dffA           DGAN--VLVYTVFAGAAQPPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIYRKLPD
3dfqA           -----------------------------------------------------------SHPALTPEQKK
3cmxA           PIYARKLGVDIDNLLCSQPDTGEQALEICDVAALTPKAEARMMSQAMRKLAGNLKQSLLIFINQIRNPET
3bb1A           R--AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVLVAKAITDSFGKGIWNK
2bhjA           IMNPKSLTRGPRDKPTPLEELLPHAIQYYGSFKEAKIEEHLARLEAVTKEIETT-GTYQLTLDELIFATK
2bbsB           WIMPGTIKENIIGVSYDEYR--------------YRSVIKACQLEEDISKFAEKDNI-VLGGITLSGGQR
1e2fA           KLLSSY----LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRY-AFSGVAFTGAKENFSLD
1e9rE           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAE--------------------
3cddF           QIEELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQR-FSKFTIKAAGIK
1e3mA           VEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEI-GPIDRIFTRVGFV
1cjaA           LNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFHSIRDIITLYTG--
2ahvA           LVKWA-LCGHWGQSPRI-SDLAEQN-KIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPGKLNEV
2d3wC           DRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDLMEEKIALLKMPEDTRSVNVGFSGGEK
1dg3A           LVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSTINQQAMDQLYYVTELTHRSKSDSADFVSFFP
2czvB           QKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYER
1e9sD           GRDKDIILNPYDQRTKGWS-----------------------FFNEIRNDYDWQRYALSVVPRGKTDEAE
3dfoD           -----------------------------------------------------------SHPALTPEQKK
3dfpD           -----------------------------------------------------------SHPALTPEQKK
3dftD           -----------------------------------------------------------SHPALTPEQKK
2c4rL           ESRPA--PFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSIKLYTGEIPLFSH
3dt4C           NLRAIN--PENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTSWKNKEW
1cr1A           TAEDL--------------IGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTHLYDSFAEAETDRL
3dfqD           -----------------------------------------------------------SHPALTPEQKK
3dftC           -----------------------------------------------------------SHPALTPEQKK
2ahwD           GLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGVDPRQQGGKLNEV
1d6jB           DGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPG-EETGLPFVEVYVDVP
2a2zB           VEKPERWSFTFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHD
3bb1E           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVTDSFGKGIWNK
3dt7A           GNLRAINPE-NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAVTITSWKNKEW
3dfnA           -----------------------------------------------------------SHPALTPEQKK
1aldA           ----------------------------------------------------------YQYPALTPEQKK
2a30A           VLQMMRWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLVYSDRYIFASNLYESECMNETEWTIYQDWHD
2d0kA           --------------AISLIAALAVDRVIGN----------ENALPWNLPADLA-WFKRNTLNKPVIYGRH
3dfnC           ----------------------------------------------------------HSHPALTPEQKK
2boeX           --------------------SSAEWVRNNPNDPRTP--VIRDRIASVPQGTWFA----HHNPGQITGQVD
3ch4B           EHGLN-FQYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWQTVRVVALEQSRQQRGWVFTPGVDD
3cmvE           -IYARKLGVDIDNLLCSQPDTGEQALEICDALAR-SGAVDVIVVDSVAALTPKAEI-EGLAARMMSQAMR
2a5jA           IIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMV-IMLIGNKSDLESR
2c9oC           KKTEVLMENFRRAIGLRIKETKKKEIIQDVTLDVAGEINKVVNKYIDQGIAELVPGV-LFVDEVHMLDIE
1e9sJ           -KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQ--------------------RYALSVVPRGKTDEAE
6aldA           -----------------------------------------------------------SHPALTPEQKK
2cckB           IKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGEVRALNEFAING
2c0bL           AAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSIKLYTGEIPLFSH
1av6A           DPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLK
1dekB           GPIKDALAYAWGVFAANTDYPLTRKEFEGI--------DYDRETNLNLTKLEVITI-MEQAFCYLNGKSP
3bgwA           KRLIVTAGSINAQKIKAARRDFASE-------------DWGKLSMAIGEISNSNINIFDKAGQSVNYIWS
2dr3B           QNMAQFGWDVKPYEEKGMFAMVDAF--------------------------TAGIGEKYIVHDLTDIREF
2b8tC           SLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGGPIA
2bwjA           SERSKLIRDIMERGDLVPSGIVLELLKMVASLGDTRGFLIDGYPREVKQGEEFGR-RIGDPQLVICMDCS
2awnA           ERGVG-----------------------------------------------------------------
2d4hA           PKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNINQQAMDQLYYVTELTHRIRSKSSPDESA
1dhjA           -----------------------ISLIAALAVDR--VIGMENAMPWNLPASLAWFK-RNTLDKPVIMGRH
1ai4B           YPASDLFAFLWGGADRVTEI--DRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSDP
1bmfC           GQKRSTVAQLVKRL--------------------------TDADAMKYTIVVSATASDAAPLQYLAPYSG
2awoC           ERGVGMVALYPHLS-------VAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
1e3mB           ---HPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAPIDRIFTRVGTFV
2bx2L           --AESRPAPFLIHQESNVIVRAFRDYLRQDIGILIDNPKVLELARQHIAALGRPDFSSKLYTGEIPLFSH
2d3wD           DRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYDFQDLMEEKIALLKMPEDL-LTRSVNVGFSGGEK
3dfnD           ----------------------------------------------------------HSHPALTPEQKK
1e59A           THTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGF-AVTPPELTKDDER
3dfpC           ----------------------------------------------------------HSHPALTPEQKK
2d2eA           DERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGEK
3cmwC           PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKA-EIEGEIGDSHMGLAAR
1e9sB           GRDKD---IILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEW-ASYGRLLLRETAKKLAL
1dhiA           ---------------ISLIAALAVDRVIGM----------ENAMPWNLPASLA-WFKRNTLDKPVIMGRH
2d4uB           ---RAGIRYMMDQNNIGSGSTVAELMESALKQAEKNWADYEALPRDPRQSTAAA-AEIKRNYDIYHNALA
2dflA           TFRWERIENMAKALGLDIDNVMNNI-----------------YYIRAINTDHQIA-IVDDLQELVSKDPS
2bbtB           SWIMPGTIKENIIGVSYDEYR--------------YRSVIKACQLEEDISKFA-EKDNIVLGITLSGGQR
1e9sM           GRDKDIILNPYDQRTKGWS---FFNEIRNDYDWQRYALSVVPRGKTDEAEEWAS-YGRLLLRETAKKLAL
1adoA           -----------------------------------------------------------SHPALTPEQKK
3d31A           KHDIAFVYQNYSLF------PHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHL-LDRNPLTLSGGEQ
2dr3F           RQNMAQFGWDVKPYEEKGMFAM--------------------VDAFTAGIGKSKEYEKYIVHDLTDIREF
1e3aB           PSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFQAATSGLTQSDP
2bhvA           ----NKLLRTITADKMIPAFLTPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYR
1accA           ----------DFNF----DQQTSQNIKNQLAELNATNIYTVLDKIKLNAK----MNILIRDKRFHYDRNN
3crmA           TAKPSRELLARYPHRLIDIRDPAESYSAA-----EFRADALAAMAKATARGRIPLLVGTMLYYKALLEGL
3czjA           --AASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQTRAPLDNDIGVSEATR
1eilA           --------------------------------------RLGYLGFAVKDVPAWDHF-LTKSVGLMAAGSA
1b0uA           RLLRTRLTMVFQHFNLWSHMTVLENVMEAPQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQ
3cr7B           LGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLYVDVPVEVAE-QRDPK
3d3qB           VTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLNYAFEDKKQVKLKL
3bczC           AHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLEDEHSIE
2awoA           ERGVG---MVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLL-DRKPKALSGGQR
3bjdB           --------------------AAYQQLLYVL---SLSDDVATAQTRRWLARAIYRVE-ERFPAADLSRALS
3bb1C           SRAGFTLNIIDTPGLIEGGYINDMALSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNK
1e2kA           ETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAP----------------HIGGEAG
1cfrA           DWYEWLIGIRAIEFFLESNFIVVKMPNATSFDMSIYKSCLSEFIYDLRSKLSL------NNVNLITSNPD
2a1fF           -----------------------------------------------------------------SQPIY
1cr2A           EETAEDLIGLHNRVRLRQSDSLKREII------------ENGKFDQWFDELFGNDTFHLYDSFEAETDRL
3bgwD           KRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQS-------VNYIWSKTRQTK
1d6jA           NIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYR-----KDRDTARQLHEVATPGEE
3a00A           NVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCI--------------------LDIDM
3cbnA           TAGHRTTFEVTVDPEI----GETADCIIGVSSSDSISTLPDEKRAIARESLVRVILRTEYGHPELTLDHP
2aunB           -------------------QPIDGRVALIAPA-SAIATEVLEATLRQLEVHGVDYHLVEARYRYLAGTVE
3bb1F           SRAGFTLNIIDTPGL-IEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAGKGIWNK
3cmuA           PIYARKLGVDIDNLLCSQPDTGEQALEICDA-------LARSGAVDVIVVDSVAALTAEIEGEIGDSHMG
1e9sH           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWAS-YGRLLLRETAKKLAL
2d7vB           --LAHENCFIA--------NSVETEVVTEII---------------------------------------
1e2iB           --VPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMP-YAVTDAVLAPHIGGEA
1e2gA           KLLSSY----LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSG-VAFTGAKENFSLD
1e9sI           FGRDKDIILNPYDQRT-KGWSFFNEIRNDYDWQ---------------------RYALSVVPRGKTDEAE
1e9rF           KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE--TAKKLAL
2bhvD           ----NKLLRTITADKMIPAFLTPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYR
3cnlA           ILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSI---GIESSFSEFFEARKRGLLKKGGVP
3dauA           ---------------ISLIAALAVDRVIGM----------ENAMPWNLPADLA-WFKRNTLNKPVIMGRH
2dr3C           QNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEYEK------------------------YIVHDLTDIREF
2d7vA           --LAHENCFIA--------NSVETEVVTEII---------------------------------------
2aumB           ------------DQTWQPIDGRVALIAPASA----IATEVLEATLRQLEVHGVDYHLVEARYRYLAGTVE
3dlbB           SDSGAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKSLLDYHASKGRLQG
1cjtC           TIAMSNLVPPVELANP------------------------------------------------------
2bjbA           PLALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGL--------------LLSAASFTDGL
1e9rD           FGRDKDIILNPYDQRTKGWS----------------------FFNEIRNDYDWQRYALSVVPRGKTDEAE
3d3qA           IPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFSEDKKQVKLKLKEE
3b55A           ------------------------------------------YNTNQIAKWLEAHA-KPLKTTNPTASLN
1cs4C           TAAMSNLVPPVELANPENQFRVDYI---------------------------------------------
2dpyB           NILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTYAMAQREIALAIGEPP
2ck3C           IGQKRSTVAQLVKRLTDADAMKYTIVV-------------------------SATASDAAPLQYLAPYSG
2d3wA           IFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDTRSVNVGFSGGEK
3dfqC           -----------------------------------------------------------SHPALTPEQKK
1e9sL           GRDKDIILNPYDQRT-------------------------------------------------------
3dfoC           -----------------------------------------------------------SHPALTPEQKK
3cioD           NLFTVSNEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPM
1e2hB           TQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDPIAALLCYPAARY
3dymA           --------------------------------SGFLSQMWIGDKKQLLTPLRDQFT-RAPLDNDIGVSEA
1culC           ETIVAAMSNLVPPVEL-ANPENQFR---------------------------------------------
1e9rG           GRDKDIILNPYDQR--------------------------------------------------------
1bglA           --------------------------------------------------------APLDNDIGVSEATR
1cr0A           AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL--------------YDSFAEAETDRL
2aumA           ---------------WQPIDGRVALIAPA----SAIATEVLEATLRQLEVHGVDYHLVEARYRYLAGTVE
2dftA           ADIFATDGEQEFRRIEEDVVRAALADHDGVLSTSPGVRAALAGHTVVYLEISAAEGVRRTGGNDRAEKYR
2a5vA           ---APSVLLGRRDGLSRVDEFEQRHVHETVAIMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGN
3di4A           GTHVTTGERLWSNLPYLRPATIIEDTLGWIGTRCDPYTGNLLAGGHYHHCCHSNLTRALADHTGLPLHEA
1e9sE           GRDKDI--ILNPYDQRTKGWSFFNEIR-----NDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
3dm9B           EAKRIGVKVIKHSYGADPAAVAYDAIQHAKAR--------------------------GIDVVLIDTAGR
2b8wB           VPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIF----ALAVLLSSTFVYNSIGTINQQAMDQLYYVTEL
3cmvB           PIYARKLGVDIDNLLCSQPDTGEQALEICD----------ALARSGAVDALTPKAE-IGLAARMMSQAMR
1draA           ---------------ISLIAALAVDRVIGM----------ENAMPWNLPAELA-WFKRNTLDKPVIMGRH
2aunA           ---------------WQPIDGRVALIAPASA----IATEVLEATLRQLEVHGVDYHLVEARYRYLAGTVE
2c9gA           ----------------------------------------------------------------------
2a5vB           --VAPSVLLGRRDGLSRVDEFEQRHVHETVAIMARSSAISERIAGGSLAIVGVTY-QLDDRAVLRDHIGN
3bk7A           VAYKPQYIKAEYEGTVYEL----------LSKIDSSKLNSNFYKTELLKPLGIIDL-YDRNVEDLSGGEL
2ancF           QGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQASHYAEYDYLIVNDDFDTALTDL
2dftC           DIFATDGEQIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGDRAEKYR
3cueF           QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-LLVGNKCDLKDK
1e2iA           YTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLI-FDRHPIAALLCYP
1dekA           VTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNF-VAFNKITDVINN
2drcA           ---------------ISLIAALAVDRVIGM----------ENAMPFNLPADLAWFK-RNTLDKPVIMGRH
4atjA           VNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADLLTIAQQSVTLAGGPS
3e8aC           EAIETIVAAMSNLV--------------------------------------------------------
5dfrA           -----------------------------------ALAVDRVIGPWNLPADLAW-FKRNTLDKPVIMGRH
2bv7A           ALMWLKRGLRFIQVFL------------QSICDGERDENHPNLIRVNATKA-------YEMALKKYHGWI
1dw9A           IGCIDDRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDVKKVADPEG-GERAVITLDGK--
2bbtA           SWIMPGTIKENIIGVSYDEYRY--------------RSVIKACQLEEDISKFAEKDNIVLGGITLSGGQR
2d2fA           ERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDERYLNEGFSGGEK
3be4A           LEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSEIIERISGRC
2e85B           --------------------SAVTDVLLCVGNSMMGDDGAGPLLAEKCAAAP------KGNWVVIDGGSA
3d1mA           -----------------------------------------------KQFIPNVAEKTLGASGRYEGKIT
1e2jA           TQHRLDQGEISAGDAAVVMTSANITMGMPYLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGS
4dfrA           ---------------ISLIAALAVDRVIGM----------ENAMPWNLPAD-LAWFKRNTLDKPVIMGRH
3c15C           VAAMSNLVPPVELANPENQ---------------------------------------------------
3c14C           VAAMSNLVPPVELA--------------------------------------------------------
3bv4A           ---------------------------------------------------------------LTPEQKK
1ek0A           NTVKFEIWDTAGQERFASLAPYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKLVGNKIDLQEGGE
2c7cH           --------AQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEG-MQFDRGYLSPYFI
3a00B           NGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASV--------------KQVSKSGKTCILDIDM
3bb1H           RAGFT--LNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLY------------VDRLDAYRVDNLDK
1c9kC           DGRPAHWRTARHLDTLITADLAPDDA----------ILLECITTMVTNLLFALGDPEQWDYAAMERAIDD
1e1qB           GQKRST-VAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDPGREAY
3d1mB           -----------------------------------------------AYKQFIPNVATLGASGRYEGKIT
1ckvA           KAISELLGRQFNVYDFLVDVSSTIG--------RAYTLGNKFTITSELMGLDRKLEDY------------
2bkeA           GTFRWERIENAKAL-------------------GLDIDNVNNIYYIRAINTDHQIAIVDDLQELVSKDPS
2dr3D           RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSK--------------------EYEKYIVHDLTDIREF
2dpyA           NILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTYAMAQREIALAIGEPP
1akeA           SELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVP
3ecpA           -------KSVFSSAALGDPRTARLVNVAAQLAITISSEGSKAAQEGAYRFIRN---PNVSAEAIRKAGAM
1e2mA           ETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAA
3bb1D           SRAGFTLNIIDTPGKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHRSEALLQVVR
3dyoA           ------------------------------------------------------TRAPLDNDIGVSEATR
1bccF           ---WYYNAAGFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLN----MRQQILPKEQWT
3bb1G           FTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNK
1e2nA           ETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEA-GSPPALTLIFDRHPIA
1e2mB           TQHRLDQGEISAGDAAVVM--TSAQITMGMPYAVTDAVLAPHIGGEAGSPPALFDRHPIAALLCYPAARY
1ak2A           LGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFS
1dyhA           ---------------ISLIAALAVDRVIGM----------ENAMPWNLPADLA-WFKRNTLDKPVIMGRH
1cjuC           VAAMSNLVPPVELA--------------------------------------------------------
3cddA           DWVPS--YDESTITISVSGRDKTADLVD-CSIDYPSGQFNNQTLTQIADIVGIKVVGEPFQRIQIEQGET
3c7kC           --VKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSR-MEDTEPFSAELLSAMMRLW
3ed8A           ---IGDGPVLLPDNHYLSYQTVLSKD--------------------------------------------
3do6A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3bm2B           ----------ALELLIN-RRSASRLAEPAPTGEQLQNILRAGRAPDIEGEGRERFSAVLEQGAIAAGSDD
1e9sA           GRDKDIILNPYDQRTKGWS---------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3dvlD           IKNARSFGWDLAKLVDEGKLFILDASPD--------PEGQEVVGGFDLSAL------IERINYAIQKYRA
3brwA           --------PISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYP-KASRLIVTFDEHVISNNFKFGVIYQKLG
3cnnA           LYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFAR--KRGLLKKGGVP
3bwdD           RLRPL---SYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHAVP
1e2lB           LGASETIANIFTTQHRLDQGEISAGD---AAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIF
1d8jA           ----------------------------GSSGYKFGVLA---KIVNYMKTRHQRGDTHLDETQHLDIGLK
1dvrA           TQLGLEAKKIMDQGGLVSDDIMVNMIKDELCKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVD
3dfdA           ELREA-YKTEDPVEVAKRVLSVGGEYANWL----------------------------------------
2e85A           --------------------SAVTDVLLCVGNSMMGDDGAGPLLAEKCAAA------PKGNWVVIDGGSA
2a1fD           ----------------------------------------------------------------------
3b9qA           SDQLEIWAERTGCE--------------------------------------------------------
1e2lA           FTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYP
3b85B           KLGFL-----PDPYLRPLHDALRDV------EPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTT
1dp0A           -------------------------------------------------LRDQFTRAPLDNDIGVSEATR
1afrA           VRELR-----------------------------------------------------------------
1e2kB           VLGASETIANI-----------YTTQHRLDQGEISAGDAAVVMTSAQITM-GMPYAVTDAVLAPHIGGEA
3c7kA           ARAMDTLGVEYGDKERKTDSKMVCD---------------------------------------------
3c85A           DELRARYGKISLGIEEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAGNQTALEQLQRRNYKG
1drbA           ---------------ISLIAALAVDRVIGM--------ENAMPW--NLPACLAWFK-RNTLDKPVIMGRH
2b0lC           ----------------------------------------------------------------------
2ccjA           PGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYI-DSSLAYQGYARG
1e9rB           ----------------------------------------------------------------------
2bhvC           ----NKLLRTITADKMIPAF-----LITPISSQIKVIAQVESDIFAHMGKAVLIPKGIGYYSNNNKMEYR
2b8tD           SRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFG
1e2nB           TQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTD-AVLAPHIGGEAGSPPALTLIFDRHPIAALLCYPAA
1azsC           ETIVA---AMSNLVPPVELANPENQF--------------------------------------------
1chdA           ----------------------------------------------------------------------
3cphA           KLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMET
2cdnA           AKRYLDAGDLVPSDLTNEL--VDDRLNNPDAANGFILDGYPRSVEQAKALHEMLE-RRGTDIDAVLEFRV
3dkvA           TPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQ--------------------
2aexA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1cjvC           IMSNLVPPVELANPENQFRV--------------------------------------------------
2an9A           EVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQI----RQ
2ancD           ----------------------------------------------------------------------
1e4vA           ELGKQAKDIMDAGKLVTDELVIALVKERIAQEDC--RNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDV
2a1fC           -----------------------------------------------------------------SQPIY
1eamA           LNGLRDVRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPD
3bjqB           ----------------------------------------------------------------------
2anbA           PRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQ
1e9sK           ----------------------------------------------------------------------
3bs4A           IRILSRFGVDVIKYLENHRLAIVDTFSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKVWMDLNLFE--
2axnA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2bsqE           -------------------EATHNAIKFRARAGRSTEAEIRLILDNIAKAQQTVRLGSASIGQEIGGVEL
1e2jB           SETIANI-YTTQHRLDQGEISAGDAAVVMT----------------------------------------
2c95B           GSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAG
3dmdA           IEQLE-----------------------------------------------------------------
1d2zD           DGPGALISLELL----------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bsqH           -------------------EATHNAIKFRAAAGRSTEAEIRLILDNIAKAQQTVRLGLASIGQEIGGVE-
2a78A           ----------------------------------------------------------------------
1d6aA           TWGKISTAIHDAKNGVLPKPLELVD---------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e2hA           ETIANIYTTQHRLDQGEISAGDAAVV--------------------------------------------
1agpA           DGETC-----------------------------------------------------------------
3cbqA           DVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGARS
2cbzA           ----------------------------------------------------------------------
1ckeA           VPLASHLDVRFVS----TNGNLEVILEGEDVSGEIRTQEVANAASQAFPRVREALLRRQRAFRELPGLIA
2bwjD           ----------------------------------------------------------------------
2ax4B           GDREENIRRIAEVAKLFADAGLVCITSFI-----SPFAKDRENARKIHESAGLPF---------------
2c9oB           ----------------------------------------------------------------------
1a2kD           TNRGPIKFNVWDTAG-------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
3cddE           VDIGGERVITGYVDDWVPSYDESTTISVSDKTADLVDYPSGQFNNQTLTQIVCKPFGIKVI-VNTDVGQR
3c94A           ----------------------------------------------------------------------
2ausA           ------------------------------------------DKRPIELHIQYGVINLDKPPGPTSHEVV


                         +         .         .         .         .         *         .:210
query           QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTMDHLK
3b5jA           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAHRLSTVKNADRIIVMEK--
2dwoA           ERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKISCYEASYQP--
2d3wB           KRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVLYQ--
3cmvH           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQA--
3cmvG           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQA--
3c95A           QRWLEHRRQVFTPEFL--QGYADELQMLVQQYKVALLKALWQYADEIV----------------------
2dwpA           ERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKISCYEASYQP--
3eiuA           SVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAR----ELHRKGIYPPINVLPSLSRLMNSGIGAGK--
2bifA           ERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEFMRRIECYENSYES--
2c61B           SVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL----HRKGIYPPINVLPSLSRLMNSGIGAGK--
1bifA           ERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATDFMRRIECYENSYES--
3dmdC           TNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDAARGGAALSISYVI--
1e69A           ALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVI-THNKIVMEAADLLHGV----
3cmvC           KLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENTRVKVVKNKIAAPFKQAEFQILYG--
3b60A           QRIAIARALLRDSPILILDEATSALDTESERAIQA-ALDELQKNRTSLVIAHRLSTIEQADEIVVVE---
2czvA           ANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISL---GVVIGMEIPQAKAS--ISMYPEII-------
1d1cA           AEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQA-MDIVGFSQEEQMSIFKIIAGILHLGN--
2b8wA           TLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRIRKFFPKKKCFVFDRPVHRRKLAQL--
3eiuB           SVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARE----LHRKGIYPPINVLPSLSRLMNSGIGAGK--
3dmdB           TNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDAARGGAALSISYVI--
2ccjB           IGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEYQEIIQRFKSVNA--
2akaB           QIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLEN--
3cmvA           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQA--
2ccgA           IGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFEKVIEGYQEIIHNES--
3b2qA           RQMGAA---RNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI--
2b8tA           KLFTYADKITKLTAICNECGAEATHSLRKIDGKH------ADYNDDIVKIGCQEFYSAVCRHHHKVP---
2bc9A           QAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKL-----------
1e9fA           WCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFLNWKMVDASKSIEAVHEDIRVLSEDAIA
3cr7C           EFTGISAPY-EAPANPEVHVKNYELPVQDA--VKQIIDYLDT----------------------------
2bbsA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHE--
2c03B           IDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDGARGGAALSARHVT--
2ccgB           IGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSDQEDLKFHEKVIEGIIHNESQRFKSVNA--
1aroP           RQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLALTSADNTTVQAVA--
3czpB           ERF-KEREKTPYKRYKITEEDWRNRDKWD--QYVDAVGDV--DRTSTEIAPWTEANDKRFARVKVLRTI-
2ctsA           LSAAITALNSESNFARAYA-EGIHRTKYWELIYEDCMDLIAKLPCVAAKIYRNLYRE-------------
2axpA           DSILELYREVSNAGLHTYSWDTGQWSSDEIKDIIFLV---------------------------------
2a2zD           WMNNQFGQSLELDGIIYLQATPETCLHRIQGIPLEYLEKLHYKESWLLHRTLKTNDYLQEVPILTLDV--
2dr3A           IEVLRQAIRDINAKRVVVDSVTTLYINKPASIILQLKRVLAGTGCTSIFVSQVSGVEHGVDGIIRLDL--
2awnD           AQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPNQVWLPVESRDVQVGANMSLGIRP--
3b85A           SKVVT-GDGLRLVRHILRGVDDVHFSELTSSDVVQLVGHIVD----------------------------
3cddD           PHELLARL-AKQRGVLLTSDTFGNLVITRASKTKAGV--SLILGDNVKAARGRFSWRQRFSKFTIKDS--
2cgtH           NKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIDVEGEALATLVVNTMRGIVKVAA--
3cddC           PHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVSLIL--GDNVKAARGRFSWRQRFSKFTIKAD--
1e98A           WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERY---ENGAFQERALRCFHQLMKDTTLNWKMVDA--
4dcgA           MLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHM--
1e9cA           WCKQPDVGLPKPDLVLFLQLQLADAAK---RGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDA--
2d62A           QRVALGRAIIRRPK-VFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHD--QVEATGDR-------
3d3kA           YKAAVAWANQNRAPVLSIDPPVHI-DAKWSLALGLPLPLGEHAGRIYLCDIGIPQVFQEVGINYHSPF--
2c61A           LRQMGAANEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEG--
3d7wA           QTKTQARSILILI--QMISEAARFNP------ILWRARQYINSGASFLPDVYMLELETSWGQQ-------
3bpbA           EKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEE---ESYAANCIWVNE--
2ausC           AWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDKIRAVMKE--
3a1wA           DEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEY------------------------------
3cr7A           EFTGISAYEAPANPEVHVKNYELPVQDAVKQIIDYLD------TKGYLPA--------------------
1e2dA           CKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYE---NGAFQERALRCFHQLMKDTTLNWKMVDA---
2cjwB           AVVFDCKFIETSAAVQHNVKE-------------------LFEGIVRQVRLRRDSKEKNERRLAYQKR--
1e9rA           IGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAS-----------------------------
1cr4A           LAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGF--AKSTGVVLVVICHLKALRQLSDTIIALER--
3dm5A           EDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEAPIGSIIVTKLDGAKGGGALSAVAATGA
2c03A           IDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDARGGAALSARHVTG--
2d4uA           ELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAVSDNN------------------
2awnC           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRHKRLGRTMIYVTHDQVAMTLADKIVVLDA--
3b2qB           SVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAR----ELHRKGIYPPINVLPSLSRLMNSGIGAGK--
1e9sG           SMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSSDKLPEHVTMPDGDFSIRSWLEDPNG--
2eg5G           SRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAIN-----------
2dr3E           IEVLRQAIRDINAKRVVVDSVTTLYINKPAMALKRVLAGTGCTSIFVSQVSVGPGVEHGVDGIIRLDL--
1e0jB           RSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNPDKG-----------
3adkA           PETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATVIAFYEKRGIVRKVNAEGSVDDVFSQV-------
3cr7D           EFTGISAPY-EAPANPEVHVKNYELPVQDA--VKQIIDYLDT--KGYLPA--------------------
2a5gA           HEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN------------------------------
3dhwC           QRVAIARALASNPKVLLCDEATSALDPATTR---------------------------------------
2a30B           WMNNQFGQSLELDGIIYLQATPLRGRNEEQGIPLEYLEKLHYKESWLLHRTLKTNDYLQEVPILTLDV--
2akaA           EEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFK--ITRQAMDIVGFSQEEQMSIFKIIAGILHLGN--
2bdtA           GERCLE-LVEEFESKGI-DERYFYNTSHLQPTNLNDIVKNLKTNPRFI----------------------
2cckA           YARGIGVEEVRALNEFAINGLYPDLTIYLNVSAERIIKNSRLDQEDLKFHEKVIEYQEIIRFKSVNAD--
3cm0A           VRRILRRAELEGRSDDN-EETVRRRLEVYREKTEPLVGYYEARGVLRVDGLGTPEVYARIRAALGI----
1bg0A           QQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHTFLVWVNEEDHLRIISMQKGGDLKTVYKRL------
3czpA           ERF-KEREKTPYKRYKITEEDWRNRDKQYVDAVGDVDRTSTEIAPWTLVEAND----KRFARVKVLRTI-
1e9dA           WCKQPDVGLPKPDLVLFLQLQLADAAK---RGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDA--
3bh0A           RKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLMARELDVVVIALSQLSRQVERQDKRPMLSD--
2a2zA           TEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIP------------------
2a30D           WMNNQFGQSLELDGIIYLQATPETCLHRIYGIPLEYLEKLHYKESWLLHRTLKTNDYLQEVPILTLDV--
421pA           RTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE------------------------------
2c9yA           DSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPL-IRRSDDNEKALKIRLQAYHTQTTPLI--
1e4yA           QADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPP-KVEGKDDVTGEELTTRKD--
2bofX           SWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFD---------
3bo6B           QFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQSQA-----LREEPFYRL----
2axzC           KPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFEHLSINGYYDLEINYLKQIYQFL----
2c04A           IDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKTGLVLTKLDGDARGGAALSARHVTG--
2cvfA           NIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRRPEGLMAYFRITER--
1e0jA           RSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNDKGKAHEEGRPVSIT
2bkhA           DIRERLHLSSDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMKKIG
2awnB           QRVAIGRTLVAEPSVFLLDEPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLDA--
3c8uA           EVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPADLEARLLDHGLNHDAAVARAQGNDLANA--
3cmtD           ETTTGGNALKFYASVRLDIRRIGAVKE-GENVVGSE---TRVKVVKNKIAAPFKAEFQILYGEGINFY--
1dkiA           QRALKENFGYNQSVHQINRGDFSKQD------WEAQIDKELSQNQPVYYQGVG----KVGGHAFVIDG--
3dt2A           RPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALS---WQHGVFV-------
3bb1B           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDEVLPNGIAWIP--
2d4hB           TPDEYLTYSLKLKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFKTKTLSGGIQVNGPRL
3da4A           QILLPGEIHIKES---------------------------------------------------------
2b8tB           KLFTYADKITKLTAICNECGAEA-------THSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVP--
3dtbB           RPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGVPLVYEALSWQHGVFVGAAMRSEA--
1e9sF           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATRGFLEGTLAESLFAGSNEASKALTSARFVLSD--
3dt4A           RPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALS---WQHGVFV-------
1e6cA           PIAEEMEAVLREREALYQDVAHYVVDATQPAIVCELMQTMR-----------------------------
2bkiA           DIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMK--
3clvA           FQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNII------------------------
2b92B           DFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKLPRLCIRKFFPKKKCFVFDRPVHRRKLAQ--
3dffA           GRWLTAHVEGRQKLAVNDHSPDSDHDL-VGEVADDIRSIIDEFDPTLVVTCAA--IGEHPDHEATRDA--
3dfqA           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHET--
3cmxA           TTGGNA-LKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKN-----KIAAPFKAEFQILYGEGINFY--
3bb1A           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVV-RSGASLKSDIPVVLIENSGRCNKNDSDE--------
2bhjA           MAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYANNGNIRSAITVFPQRDGKHDFRLWN--
2bbsB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHE--
1e2fA           WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYE--NGAFQERALRCFHQLMKDTTLNWKMVDA---
1e9rE           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALT------
3cddF           ADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVT-GWRIPQTGKLWNINTLVP--
1e3mA           ETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACNLANKIKALTLFATHYFETQLPEKEGVANVH--
1cjaA           YDVGTEGSISMQEGFLATVRECASFDLDAFERELLSWQESSISPQAIPFILRMLRI--------------
2ahvA           TKEDLIKLVEFDNKEYLYYKAI-APDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVH----------
2d3wC           KRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTH-YQRILDYIKPDYVHVLYQ--
1dg3A           DFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHELDPE--
2czvB           ANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIMEIPQAKASISMYPEII-------------
1e9sD           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDFLEGTLAESLFAGSNESKALTSARFVLSD--
3dfoD           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF----
3dfpD           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF----
3dftD           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF----
2c4rL           YQIESQIESAFQRGGSIVIDSTEALTAIDINSARGDIEETFNTNLEAADEIARQLRLRDLGGLIVIDF--
3dt4C           RPQDEEPCAHPNSRFCTPASQCPIIDPAWEPIEGIIFGGRRPAGVPLVYEALS---WQHGVFV-------
1cr1A           LAKLAYMRSGLGCDVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHLKALRQLSDTIIALER--
3dfqD           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF----
3dftC           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF----
2ahwD           TKEDLIKLVEFDNKEYLYYKAI-APDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMM--
1d6jB           VEVAEQRAPYEAPANPEVHVKNYELPVQD--AVKQIIDYLDTKG--------------------------
2a2zB           WMNNQFGQSLELDGIIYLQATPLRGRNEEQGIPLEYLEKLHYKESWLLHRTLKTFDYLQEVPILTLD---
3bb1E           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENSGRCNKNDSDEKVLPN--
3dt7A           RPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALSW----------------
3dfnA           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHET--
1aldA           ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHET--
2a30A           WMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLHYKESWLLHRTLKTNDYLQEVPILTLDV--
2d0kA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAAGDVPEIVIGGGRVYEFLPKAQKLYLTHI--
3dfnC           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHET--
2boeX           ALMSAAQAAGKIPILVVSNAPGRDCGGAYRSWIDEFAAGLKNRPAYIIVEPDLSLMSSCMQHVQQEVLET
3ch4B           AESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFI---------------------------------
3cmvE           KLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSRVKVVKNKIAAPFKQAEFQI--
2a5jA           RDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL---------------------
2c9oC           CFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVM-IIRTMLYTPQEMKQIIKIRA
1e9sJ           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKAL-------
6aldA           ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN-------------
2cckB           LYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIRFKSVNADQPLEVVEDTYQTIIK-YLE
2c0bL           YQIESQIESAFQREVRLPSGGSIVIDSTEA-------LTAIDINSARDIEETAFNTNLEAADEIAR----
1av6A           WRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKK----------
1dekB           IKGVFV-FDDEGKESVNFVAFNKITDVINNIEDQWSVRRLQALGTDLIVNNFDRMYWKLFALDYLDKF--
3bgwA           KTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQKKMARELDVVVIALSQLSRVEQRQDKRPMLSD--
2dr3B           IEVLRQAIRDINAKRVVVDSVTTLYINKPASIILQLKRVLAGTGCTSIFVSQVSVERGFGGPGVEHGV--
2b8tC           KLFTYADKITKLTAICNECGAEATHS------LRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPN--
2bwjA           ADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPFLQLCTAID---
2awnA           ----------------------------------------------------------------------
2d4hA           DFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLLPRLCIRKFFPKKKCFVFDRPVHRRKLAQ--
1dhjA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIIGGGRVYEQFLPKAQKLYLTHI--
1ai4B           RRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDWYSASGYETTQDGPT--
1bmfC           CSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGS
2awoC           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA--
1e3mB           ETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACNLANKIKALTLFATHYFETQLPEKEGVANVH--
2bx2L           YQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAAD-EIARQLRLRDL--
2d3wD           KRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNS-LRDGKRSFIIVTHYQLDYIKPDYVHVLYQ--
3dfnD           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHET--
1e59A           YPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSE--
3dfpC           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHET--
2d2eA           KRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQLNYIQPDKVHVMMD--
3cmwC           MMSQAMNLKQSNTLLIFINQIRMKIGVMFGNPGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKV--
1e9sB           IGTPSMRELFHWTTIATFDD--------------------------------------------------
1dhiA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYEFLPKAQKLYLTHI--
2d4uB           ELIQLLGAGKINE---FFDQPTQGYQDGFEKAYMEQNDRLHDI---------------------------
2dflA           IKLIVVDSVTSHFRAEYPGRENLAVRQQKNKHLHQLTRLAEVYDIAVIITNQVMTLYHVPGIRIQLKK--
2bbtB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHE--
1e9sM           IGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARF---------------------
1adoA           ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHET--
3d31A           QRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVHKKNKLTVLHITHDQTARIMADRIAVVMD--
2dr3F           IEVLRQAIRDINAKRVVVDSVTTLYINKPASIILQLKRVLAGTGCTSIFVSQVSGVEHGVDGIIRLDL--
1e3aB           RRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDWYSASGYETTQDGPT--
2bhvA           LDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPGDYLLMQLMRQSGMGINQVVNQI-------
1accA           IAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKI-----LSGYIVEIEDTEGLKEVINDRYDMLNI--
3crmA           PYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLSIRAVGYRQVWDYLDGKLSYAEMT
3czjA           IDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTYRIDGSGQMAITVD--
1eilA           GDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDALERMADKLRQAGVAFTRGDEA-LMQQRKVMGLL--
1b0uA           QRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEGFARHVSSHVIFLHQ--
3cr7B           GLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKG-----------------
3d3qB           KELELNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIFTENYDTLLIGIESRETLYLRINKRVDILGH--
3bczC           HLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQ-----------
2awoA           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGMIYVTHDQVEAMTLADKIVVLDA--
3bjdB           QEIAAQSRERHPSQVFSGSASRAQLQVFLRHQWFRTFRLYRDAADLLVN-LTDVDEAAALARYLYGEL--
3bb1C           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQ-VVRSGASLKSDIPVVLIENSGRCNKNDSDEKVLPNG--
1e2kA           PPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLA--FVALIPPTLPGTNIVLGALPEDRHIDR----
1cfrA           FSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELHIKSFLS-----------------
2a1fF           KRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGLFRGAKLAKAGMNR--
1cr2A           LAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGF--AKSTGVVLVVICHSGALRQLSDTIIALER--
3bgwD           RKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLMARELDVVVIALSQLSRQVERQDKRPMLSD--
1d6jA           TGLPFVEVYVDVPVEAPYEAPANKNYELPVQDAVKQIIDYLDTKGYLP----------------------
3a00A           QGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYKELKDFIFA--------------------
3cbnA           TDIVCRKSDYICSRTLIRADKAAFDLDENLVRDLR--------KGRELKVEII-----------------
2aunB           QRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSA-----------
3bb1F           AIVALTHAQFSPPDGLPYDEFFSKRSEAL-LQVVRSGASLKKDIPVVLIENSGRCNKNDSDEKVLPNG--
3cmuA           LAARMMSQAMRKLAGNLKQSNTLLI--FINQIRMKIGVMFGNPETTTGGNALKFYAS-------------
1e9sH           IGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLEHVTMPDGDFSIRSW-
2d7vB           ----------------------------------------------------------------------
1e2iB           HAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGT-------------------
1e2gA           WCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF--------QERALRCFHQMKDTTLNWKMVDA--
1e9sI           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSAR---
1e9rF           IGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASK--ALTSARFVLSDKLPEHVTMPDGDF--
2bhvD           LDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVP------------------------------
3cnlA           DIERALMLFFTKAGRVSFERPE------------------------------------------------
3dauA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACGDVPEIMVIGGGRVYEFLPKAQKLYLTHI--
2dr3C           IEVLRQAIRDINAKRVVVDSVTTLYINKPASIILQLKRVLAGTGCTSIFVSQVSGVEHGVDGIIRLDL--
2d7vA           ----------------------------------------------------------------------
2aumB           QRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSA-----------
3dlbB           REGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALSLPWEERRRTREIASWGRRLGLGTPEAVRAQ--
1cjtC           ----------------------------------------------------------------------
2bjbA           TVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARWDIEPDLTAVAFLSAA-------
1e9rD           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEAESLFAGSNESKALTSARFVLSD--
3d3qA           YLASFDKESAKDIHPNNRKRVLRAIEYYTKKLLKKVQQFTENYDTLLIGIESRETYLRINKRVDILGH--
3b55A           DLKPLKNVG--SASIVGLGEATHGAHEVFTKHRIVKYL-VSEKGFTNLVLEEGWDALELDRYVLTGK---
1cs4C           ----------------------------------------------------------------------
2dpyB           ATKGYPPSVFAKLPALV-----------------------------------------------------
2ck3C           CSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGS
2d3wA           KRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQLDYIKPDYVHVLYQ--
3dfqC           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIGGVILFHET--
1e9sL           ----------------------------------------------------------------------
3dfoC           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIGGVILFHET--
3cioD           LAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIK----------------
1e2hB           LMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRYLQC--
3dymA           TRINAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTRIDGSGQMAITVDV--
1culC           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1bglA           IDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQQGKTLFISRKTYIDGSGQMAITVDV--
1cr0A           LAKLAYMRSGLGCDVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALSDTIIALER--
2aumA           QRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIG-----FADISVLLSAFHRH--
2dftA           ALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL----------------------------------
2a5vA           I---------------------------------------------------------------------
3di4A           ELVHDVLNVFCTGGQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEASC----HPLLVEIFAP--
1e9sE           LALIGTPSMRELFHWTTIAT--------------------------------------------------
3dm9B           SETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDADARGGAALSISYVID
2b8wB           THRIRSKSSVSFFPDFVWTLRDFSLDLEAQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPK--
3cmvB           KLAGNLKQS-NTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAE--
1draA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYEFLPKAQKLYLTHI--
2aunA           QRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPIGFSDISVLLSAFHRHGLPAIH--
2c9gA           ----------------------------------------------------------------------
2a5vB           IG--------------------------------------------------------------------
3bk7A           QRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDVLIDYVSDRLIVFE---
2ancF           KTIIRAERLRMSRQKQRHDALISKLL--------------------------------------------
2dftC           ALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL----------------------------------
3cueF           RVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESM-------------------------
1e2iA           AARYLMGSMTPQAVLAFVALIPPTLPGTLPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLA------
1dekA           IEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFAL------------------------------------
2drcA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVEIMVIGGGRVYEFLPKAQKLYLTHI--
4atjA           WRVPLGRRDSLQLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNCRFIMDRLYNFS---
3e8aC           ----------------------------------------------------------------------
5dfrA           TWESIGRPLPGRKNIILSSQPGTDDRVTWKSVDEAIAACGDVPEIMVIGGGRVYEFLPKAQKLYLTHI--
2bv7A           VQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYE-----------------
1dw9A           ----------------------------------------------------------------------
2bbtA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHE--
2d2fA           KRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFLVITHYQRILNYIQPDKVHVMMD--
3be4A           THPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVHKQTAPLVFYEDLGILKRVNAK--
2e85B           PENDIVAIRELRPTLLIVDATDMGLNPGEIR-----IIDPDDIAEMFMMTTHNMPLNYLIDQL-------
3d1mA           RNSERFKELNYNPDIIFKDEENTGADRLMTQRCKDKLNALAIPGVKLRVTEGWDEDGHHSEESLHYE---
1e2jA           MTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLAMLAAIRRVYGLLANTVRYLQC--
4dfrA           TWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEFLPKAQKLYLTHI--
3c15C           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3bv4A           ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIGGVILFHET--
1ek0A           RKVA------------------------------------------------------------------
2c7cH           NKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKLLIIAEDVEGEALATVVNTMRGIVKVAA--
3a00B           QGVKSVKAIPELNARFLFIAPPSGAHD---KVIVNDDLDKAYKELKDFIFAE------------------
3bb1H           LVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSLLQVVRSGASLKKDSDIPVVLIENS--
1c9kC           EIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLA--------AAADEVWLVVS--
1e1qB           PGDVFYLHSRLLERAAKMNDAFG----GGSLTALPVIETQAGDVSAYIPTN----VISITDGQIFLET--
3d1mB           RNSERFKTPNYNPDIIFKDEENTGADRLMTQRCKDKLSVMNQWPGVKLRVTEGWDEDGHHSEESLHYE--
1ckvA           ----------------------------------------------------------------------
2bkeA           IKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLEVYDIAVIITNQVVP--GIRIQLKKSRG--
2dr3D           IEVLRQAIRDINAKRVVVDSVTTLYINKPASIILQLKRVLAGTGCTSIFVSQVSVERGFGGPGVEHGV--
2dpyA           ATKG------------------------------------------------------------------
1akeA           DELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTQMTAPLIGYYSKAEAGNTKYAKVDG--
3ecpA           QTVKLAQ----EFPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLH--
1e2mA           LLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPED---------------------------
3bb1D           SGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLV-QTITEVALNKSESIFVDKNLI-------
3dyoA           IDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQQGKTLFISRKTYRIDGSGQMAITVD--
1bccF           KYEEDVPYLEPYLKEVI-----------------------------------------------------
3bb1G           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSG---ASLSDIPVVLIENSGRCNKNDSDEKVLPN--
1e2nA           ALLCYPAARYLMGSMTPQAVLAVALIPPTLPGTNIVLGALPEDRHIDRLA--------------------
1e2mB           LMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRYLQC--
1ak2A           DSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSKKALKIRLEAYHTQTTPLVEYYS--
1dyhA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIMVIGGGRVYEFLPKAQKLYLTHI--
1cjuC           ----------------------------------------------------------------------
3cddA           PHELLAR-LAKQRGVLLTSDTFGKTKAGVSLILGDNVKAARGFSWRQRFSKFKAAKADVTDSEIGR----
3c7kC           GDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTKTTGIVETHFTFKNLHFRLFDV--
3ed8A           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3bm2B           KAIDKARNAPFRAPLIITVVAKVPRWEQESAGCAVAQAAVAQGFGGIWR-SGALTESPVVREAFGCRE--
1e9sA           ----------------------------------------------------------------------
2a1fE           -QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNFRGAKLAKAGMNR--
3dvlD           RRVSID--------SVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFV-
3brwA           ATSEEE-LFSTNEESPAFVEFLEFLGQKVKLQDFKGFRGHGQTGTESVYCNFRNLPYTEGDAQQLQRK--
3cnnA           DIERALMLFFTKAGRVSFERPE------------------------------------------------
3bwdD           ITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVL-----------------------------
1e2lB           DRHPIAALLCYPAARYLMGS----MTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLA
1d8jA           QKQWLMTALVNNPKIEVIDGKYAFKPKYNVR---------------------------------------
1dvrA           DELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQ---------------------------
3dfdA           ----------------------------------------------------------------------
2e85A           PENDIVAIRELRPRLLIVDATDMGLNPGEIRIIDP-----DDIAEMFMMTTHNMIDQLKEDIGEVIFL--
2a1fD           -QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGNLFRGAKLAKAGMNR--
3b9qA           ----------------------------------------------------------------------
1e2lA           AARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGIDRLAKRQRPGERLDLAMLRRVYGLLANTVRYLQC--
3b85B           PAQKFLTRLGFGSKVVTGDSGLRLVRHILRGVDDHFSELTSSDVVRHQLVGHI-----------------
1dp0A           IDPNAWVERWKAAGHYQAEAALLQCTATLADAVLITTAHAWQHQGKTLFISRKYRIDGSGQMAITVDV--
1afrA           ------------NTARQAKEHGDIKLAQICGTIAA-----DEKRHETAYTKIVEKLFEIDPDGTVLAF--
1e2kB           HAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKR
3c7kA           ----------------------------------------------------------------------
3c85A           QIAAIAEY-PDQLEGLLESGVDAAFNIYSEAGSGFARHVCKQLQFTSI----------------------
1drbA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIMVIGGGRVYEFLPKAQKLYLTHI--
2b0lC           ---------MSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIASVIVNALRKLESAGVIES--
2ccjA           IGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEKFHEKVIEGYQEIIHRFKSVNA--
1e9rB           ----------------------------------------------------------------------
2bhvC           LDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGV-------------------------------
2b8tD           EPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIGKHADYNDDIVKIGCQEFYSAVCRHHHKVPN--
1e2nB           RYGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYG-LLANTVRYLQCG-
1azsC           ----------------------------------------------------------------------
1chdA           --------LLSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITQHMPPTRSFAERLNKLCQIS
3cphA           RVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGV-----------------
2cdnA           SEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQ---LKTVDAVGTMDEVFARA-------
3dkvA           ----------------------------------------------------------------------
2aexA           ----------EEDELAHRCSSFMAPPVTDLGELRRRPGDQAQVCQALAQVDGGAFSVDRWERKEGGGG--
2bboA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2an9A           KMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDDFDTALTDLKTIIRAER--
2ancD           ----------------------------------------------------------------------
1e4vA           PDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKPLIGYYSKEAEAGNTKYAKVDG--
2a1fC           KRILLK-----LSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGNLFRGAKLAKAGMNRVV
1eamA           QWIKDFYIPHGNKMLQPFAP----------SYSAEMRLLSIYTGENMRLTRVTKSDAVNYAKKMYYLN--
3bjqB           ARVV---DPI------LSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLYNTKRNTKR----
2anbA           KMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAHYAEYDYLIVNDDFDALTDLKTIIRAER--
1e9sK           ----------------------------------------------------------------------
3bs4A           GRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWLLSVYRRADYVLKTR---
2axnA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2c5mD           SCGLHVTS-IKIDPYINIDAGLTKDNNLTTGKIYQYVIKGDYLGKTVQVVPHITAIQEWVMRQALEPQ--
2bsqE           EDVR------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2c95B           PETMTQRLLKRGETSGRVDDNEETIKKRLETYATEPVIAFYEKRGIVRKVNAEGSVDSVFSQV-------
3dmdA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bsqH           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3cbqA           REVSLEEGRHLAGTLSCKHIETSAALH---HNTRELFEGAVR----------------------------
2cbzA           ----------------------------------------------------------------------
1ckeA           DGRDMGTVVFPDAPVKI--FLDASSEERAHRRMLQLQVKGFSVN-FERLLAEIKLVPAADALVLDSTTL-
2bwjD           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
3ci2A           --------------------------GKSVEEAKKVILQDKPEAQIIVLPVGTIVMEYRIDRVRLFVD--
3cddE           IQIEQGETPHELLARLAKQRGVLLTSDTFGNLVKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIKDV--
3c94A           ----------QQSTFLFHDYETFGTHPALDR-PAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQPG---
2ausA           AWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDK---------