[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56413.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dh3B.bssp"
#ERROR : Can't open dsspfile "3dh3A.bssp"
#ERROR : Can't open dsspfile "3dh3C.bssp"
#ERROR : Can't open dsspfile "2apoA.bssp"
#ERROR : Can't open dsspfile "3dpuB.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"
#ERROR : Can't open dsspfile "2ab4A.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"
#ERROR : Can't open dsspfile "3bbnD.bssp"
#ERROR : Can't open dsspfile "1c05A.bssp"
#ERROR : Can't open dsspfile "1dm9B.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2cqjA.bssp"

## Summary of PDB Search
:240
    3e-38  30%  3dh3B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    8e-35  28%  3dh3A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    2e-31  26%  3dh3C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    4e-24  11%  2apoA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    2e-17   9%  3dpuB  [x.x.x] RAB FAMILY PROTEIN
    2e-17  15%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
    3e-15  18%  2ab4A  [x.x.x] TRNA PSEUDOURIDINE SYNTHASE B
    4e-12  18%  1dm9A  [d.66.1] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    1e-11  14%  3bbnD  [x.x.x] RIBOSOMAL PROTEIN S4
    3e-09  13%  1c05A  [d.66.1] RIBOSOMAL PROTEIN S4 DELTA 41
    3e-08  25%  1dm9B  [d.66.1] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    2e-06  11%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    2e-05  10%  2cqjA  [x.x.x] U3 SMALL NUCLEOLAR RIBONUCLEOPROTEIN PROTEIN
:240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEFVYYMMNKPKG
3dh3B           VRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIEPREADLVLIALNKPVG
3dh3A           VRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIEPREAEDLVLIALNKPV
3dh3C           VRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIEPREAEDLVLIALNKPV
2apoA           -------------------------ELIVKEEVET------NWDYGCNPYERKIEDLIKYGVVVVDKPRG
3dpuB           RIINSSKTKNGHLNTSALGYILNEENNKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIYDY
2ausA           -------------ADIKREVIVKDDKAETNPKWGFPPD------------KRPIELHIQYGVINLDKPPG
2ab4A           -------------------------------------------------------------ILVAYKPKG
1dm9A           VRLDKWLWAARFYTRALAREMIEGGKVHYNGQRSKPSKIVELNATLTLRQGNDERTVIVKAITEQRRPAS
3bbnD           MRLDNILFLGMAPTIPGARQLVNHRHILVNGRIVDIPSYRCKPQ-DTIMARDEQKSIALIQNSLDLSPRE
1c05A           SRLDNLVYLGLARTRRQARQLVTHGHILVDGSRVNIPSYRVKPG-QTIAVREKSRNIPDYLSFDPEKMEG
1dm9B           VRLDKWLWAARFYTRALAREMIEGGKVHYNGQRSKSKIVELNATL-TLRQGNDERTVI------------
2ausC           ----------------------------IKREVIVKDDKAETNPKWGFPPDKPIELHIQYGVINLDKPPG
2cqjA           RRLPTVLLLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRS------MEDFVTWVDSSKISGPSS--


                         .         .         *         .         .         .         .:140
query           VISATEDPKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGI
3dh3B           IVSTTEDGERDNIVD---FVNHSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
3dh3A           GIVSTTEDGERD--NIVDFVNHSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
3dh3C           GIVSTTEDGERDNIVDFVNHSK--RVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
2apoA           PTSHEVSTWVK-------KILNLDKAGHGGTLDPKVTGVLPVALERATKTIP--MWHIPPKEYVCLMHLH
3dpuB           LPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQPRCKREYLSIIWYEI
2ausA           PTSHE-------VVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATR--VVQALLPAGKEYVALMHLD
2ab4A           PTS-------HDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGVNQ--GTRILEFYKDLKKVFWVKMRLG
1dm9A           EAALLYEETAESVEKREKM---------------------------------------------------
3bbnD           EL------PKHLTLNPFPYKGLVNQIIDSKWVGLKINELLV-----------------------------
1c05A           TYTRLPERSELAEINEA-----------------------------------------------------
1dm9B           ----------------------------------------------------------------------
2ausC           PTSHEVVAWIKRILNLEKA-------GHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGD
2cqjA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTM
3dh3B           ITEEFIRGMSAGVPILGTVTKKCKVKKE------APFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
3dh3A           ITEEFIRGMSAGVPILGTVTKKCKVKKE------APFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
3dh3C           ITEEFIRGMSAGVPILGTVTKKCKVKKE------APFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
2apoA           RDASEEDILRVFKEFTGRIYQRIRKIHELELLDKDGKDVLFRVKCQSGTYIRKLCEDIGEALG-------
3dpuB           KKINANFTNLDVIPLPGHPDELVEYKELLGLEKMGR----------------------------------
2ausA           VPEDKIRAVMKEFEGEIIQRKVYYIEILEIDGRDVLFRVGVEAGTYIRSLIHHIGLALG-----------
2ab4A           LITETYKLAREGKIINLPPKRVKIFKIW--DVNIEGRDVSFRVEVSPGTYIRSLCMDIGYKLGELVRESV
1dm9A           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
1dm9B           ----------------------------------------------------------------------
2ausC           VPEDKIRAVMKEFEGEIIQRTRKVYYIE--ILEIDGRDVLFRVGVEAGTYIRSL----------------
2cqjA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GTLVLDENLERGEWRRLTKEELEILRANII
3dh3B           MNVSL-SGIPLGEWRDLTDDELIDLFK---
3dh3A           MNVSL-SGIPLGEWRDLTDDELIDLF----
3dh3C           MNVSL-SGIPLGEWRDLTDDELIDLF----
2apoA           ------------------------------
3dpuB           ------------------------------
2ausA           ------------------------------
2ab4A           GPHTIEESLNVFEAAPEEIENRIIPLEKCL
1dm9A           ------------------------------
3bbnD           ------------------------------
1c05A           ------------------------------
1dm9B           ------------------------------
2ausC           ------------------------------
2cqjA           ------------------------------