[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56432.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0hA.bssp"
#ERROR : Can't open dsspfile "1dpeA.bssp"
#ERROR : Can't open dsspfile "3dp8C.bssp"
#ERROR : Can't open dsspfile "3dp8B.bssp"
#ERROR : Can't open dsspfile "1dppA.bssp"
#ERROR : Can't open dsspfile "3dp8A.bssp"
#ERROR : Can't open dsspfile "1b52A.bssp"
#ERROR : Can't open dsspfile "3e3kB.bssp"
#ERROR : Can't open dsspfile "3drgA.bssp"
#ERROR : Can't open dsspfile "3drhA.bssp"
#ERROR : Can't open dsspfile "3drjA.bssp"
#ERROR : Can't open dsspfile "2d5wA.bssp"
#ERROR : Can't open dsspfile "3drfA.bssp"
#ERROR : Can't open dsspfile "3c18A.bssp"
#ERROR : Can't open dsspfile "3c18B.bssp"
#ERROR : Can't open dsspfile "2d05A.bssp"

## Summary of PDB Search
:652
    4e-50  23%  1b0hA  [c.94.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    5e-50  20%  1dpeA  [x.x.x] DIPEPTIDE-BINDING PROTEIN
    7e-50  18%  3dp8C  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    9e-50  17%  3dp8B  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    3e-49  19%  1dppA  [c.94.1] DIPEPTIDE BINDING PROTEIN
    2e-48  17%  3dp8A  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    2e-47  23%  1b52A  [c.94.1] PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
    2e-46  17%  3e3kB  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    6e-45  19%  3drgA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    7e-43  18%  3drhA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    7e-43  19%  3drjA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    1e-42  15%  2d5wA  [x.x.x] PEPTIDE ABC TRANSPORTER, PEPTIDE-BINDING PROTEIN
    4e-42  18%  3drfA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    4e-16  13%  3c18A  [x.x.x] NUCLEOTIDYLTRANSFERASE-LIKE PROTEIN
    1e-15  13%  3c18B  [x.x.x] NUCLEOTIDYLTRANSFERASE-LIKE PROTEIN
    2e-08  15%  2d05A  [x.x.x] CHITOSANASE
:652

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxSACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLEN
1b0hA           ----------------------VPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLIS
1dpeA           --------------------------------KTLVYCSEGSPEGFNQLFISGTTYDASSVPLYNRLVEK
3dp8C           ---------------------------------EITTAWPVNVGPLNP-HLYTPNQMFAQSMVYEPLVKY
3dp8B           --------------------------------DEITTAWPVNVGPLNP-HLYTPNQMFAQSMVYEPLVKY
1dppA           --------------------------------KTLVYCSEGSPEGFNQLFTSGTTYDASSVPLYNRLVEK
3dp8A           ------------------------------APDEITTAWPVNVGPLNP-HLYTPNQMFAQSMVYEPLVKY
1b52A           ---------------------------QLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLIS
3e3kB           --------------------------------DEITTAWPVNVGPLNP-HLYTPNQMFAQSMVYEPLVKY
3drgA           ----------------------VAYQNPDKAIKNLKVAYQSDSPMKAQWNDATFATMSGPGGGQDGLFFT
3drhA           ----------------------VAYQNPDKAIKNLKVAYQSDSPMKAQWNDATFATMSGPGGGQDGLFFT
3drjA           ----------------------VAYQNPDKAIKNLKVAYQSDSPMKAQWLSGLSNDATGPGGGQDGLFFT
2d5wA           ------------------------------QDNSLVIGASQEPRVLARVISNQAIKSEIEQYLFAPFIGF
3drfA           ---------------------------------NLKVAYQSDSPMKAQWNDATFATMSGPGGGQDGLFFT
3c18A           ----------------------------------------------------------------------
3c18B           ----------------------------------------------------------------------
2d05A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDS
1b0hA           DVEGHPSPGVAEKWE-NKDFKVWTFHLRENAKWSDGT-----PVTAHDFVYSWQRLADPNTAASYLQYGH
1dpeA           IGTTEVIPGLAEKWEVSEDGKTYTFHLRKGVKWHNKEFKPTRELNADDVVFSFDRQKNAQNPYHK----V
3dp8C           QADGSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGE---PFDAEAAAENFRAVLDNRQRHAW-----
3dp8B           QADGSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGE---PFDAEAAAENFRAVLDNRQRHAW-----
1dppA           IGTTEVIPGLAEKWEVSEDGKTYTFHLRKGVKWHNKEFKPTRELNADDVVFSFDRQKNAQNPYHK----V
3dp8A           QADGSVIPWLAKSWTHSEDGKTWTFTLRDDVKFSNGE-----PFDAEAAAENFRAVLDNRQRHAW-----
1b52A           DVEGHPSPGVAEKWE-NKDFKVWTFHLRENAKWSDGT-----PVTAHDFVYSWQRLADPNTASPYASYLQ
3e3kB           QADGSVIPWLAKSWTHSEDGKTWTFTLRDDVKFSNGE-----PFDAEAAAENFRAVLDNRQRHAW-----
3drgA           DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGS---EVTAKDYEFTYETIANPASDRWTDSLAN
3drhA           DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGS---EVTAKDYEFTYETIANPASDRWTDSLAN
3drjA           DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGS---EVTAKDYEFTYETIANPASDRWTDSLAN
2d5wA           NADSQNFPVLATEVGGGKKRLEMDITIRPDAKW--SDGR---PITTEDVAFYFEVGKAKGMNPDFWERVN
3drfA           DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGS---EVTAKDYEFTYETIANPASDRWTDSLAN
3c18A           ----------------------------------------------------------------------
3c18B           ----------------------------------------------------------------------
2d05A           GGSDTLQGLLARSGSSSNEKTFMKNFHAKRTLV--VDTNPNKPPNGKNRVKQWDTLVDMGKMNLKNVDSE


                         +         .         .         .         .         *         .:210
query           VAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS
1b0hA           IANIDDIIAGKK-PATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKW--TQPAN
1dpeA           SGGSYEYFEGMGLPELISEVKKVDDNTVQFVLTRPEAPFLADLAMDFASILSKEYADAMMKAGTPEKDLN
3dp8C           -LELANQIV---------DVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETM--NGIKA
3dp8B           -LELANQIV---------DVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETMNGIKA--
1dppA           SGGSYEYFEGMGLPELISEVKKVDDNTVQFVLTRPEAPFLADLAMDFASILSKEYADAMMKAGTPEKDLN
3dp8A           -LELANQIV---------DVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETMNGIKA--
1b52A           YGHIADDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKW--TQPAN
3e3kB           -LELANQIV---------DVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETMNGIKA--
3drgA           IVGLSDYHTGKAKTISGIFPDGENGKVIKVQFKEMKPGMTQSGNGYFLETVAPYQYAPKDLASSPKTTTK
3drhA           IVGLSDYHTGKAKTISGIFPDGENGKVIKVQFKEMKPGMTQSGNGYFLETVAPYQYLKDVLASSPKTTTK
3drjA           IVGLSDYHTGKAKTISGIFPDGENGKVIKVQFKEMKPGMTQSGNGYFLETVAPYQYLKDVLASSPKTTTK
2d5wA           VRIKDARYYDTYGPINTYAPKHIMGPEWERVKAAARGLDPDKDAEKLNELYRNFFLKFATPQALNRGA--
3drfA           IVGLSDYHTGKAKTISGIFPDGENGKVIKVQFKEMKPGMTQSGNGYFLETVAPYQYLKDVAPKDLASTTK
3c18A           ------YSEYA-AYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLSRW
3c18B           ------YSEYA-AYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLVHE
2d05A           IAQVTDW---------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSS
1b0hA           IVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVIN--QVTYLPISSEVTDVNRYRSGEIDMTYNNMPIEL
1dpeA           PIGTGPFQLQQYQKDSRIRYKAFDGYWGTKPQI---DTLVFSITPDASVRYAKLQKNECQVMP-YPNPAD
3dp8C           PIGTGPWILQESKLNQYDVFVRNENYWGEKPAI---KKITFNVIPDPTTRAVAFETGDIDLLYGNEGLLP
3dp8B           PIGTGPWILQESKLNQYDVFVRNENYWGEKPAI---KKITFNVIPDPTTRAVAFETGDIDLLYGNEGLLP
1dppA           PIGTGPFQLQQYQKDSRIRYKAFDGYWGTKPQI---DTLVFSITPDASVRYAKLQKNECQVMPYPNPADI
3dp8A           PIGTGPWILQESKLNQYDVFVRNENYWGEKPAI---KKITFNVIPDPTTRAVAFETGDIDLLYGNEGLLP
1b52A           IVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVIN--QVTYLPISSEVTDVNRYRSGEIDMTYNNMPIEL
3e3kB           PIGTGPWILQESKLNQYDVFVRNENYWGEKPAI---KKITFNVIPDPTTRAVAFETGDIDLLYGNEGLLP
3drgA           PLVTGPFKPENVVAGESIKYVPNPYYWG-EKPKLNSITYEVV---STAKSVAALSSSKYDIINGMV--SS
3drhA           PLVTGPFKPENVVAGESIKYVPNPYYWGEK-PKLNSITYEVV---STAKSVAALSSSKYDII--NGMVSS
3drjA           PLVTGPFKPENVVAGESIKYVPNPYYWGEKPKLNSITYEVVSTAKSVAALSSSKYDIIN-----GMVSSQ
2d5wA           MVYSGPFKLKRWVPGNSIEMERNPNFPIKPEGGKYVQKVVYRFIQNTNSLLVAVIGGSIDATSSVSLTFS
3drfA           PLVTGPFKPENVVAGESIKYVPNPYYWGEKPKLNSITYEVVSTAKSVAALSSSKYDIING-----MVSSQ
3c18A           LILNANRRAVHWVSEGTIIFERNDYLTDLKQLRNFPETERCLQSLSFAKLLRRFQDGRNLFSRGNY----
3c18B           LILNANRRAVHWVSEGTIIFERNDYLTDLKQLRNFPETERCLQSLSFAKLLRRFQDGRNLFSRGNY----
2d05A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYG
1b0hA           FQKLKKEIPNEVRVDPYLCT-YYYEINNQKAPFN------------------DVRVRTALKLALDR----
1dpeA           IARM-KQDKSINLMEMPGLNVGYLSYNVQKKPLD------------------DVKVRQALTYAVNKDAI-
3dp8C           LDTFARFSQNPHTQLSQPIETVMLALNTAKAPTN------------------ELAVREALNYAVNKKSLI
3dp8B           LDTFASQNPAYHTQLSQPIETVMLALNTAKAPTN------------------ELAVREALNYAVNKKSLI
1dppA           AR--MKQDKSINLMEMPGLNVGYLSYNVQKKPLD------------------DVKVRQALTYAVNKDAI-
3dp8A           LDTFARFSQNPHTQLSQPIETVMLALNTAKAPTN------------------ELAVREALNYAVNKKSLI
1b52A           FQKLKKEIPNEVRVDPYLCT-YYYEINNQKAPFN------------------DVRVRTALKLALDR----
3e3kB           LDTFARFSQNPHTQLSQPIETVMLALNTAKAPTN------------------ELAVREALNYAVNKKSLI
3drgA           QYKQVKNLKGYKVLGQQAMYISLMYYNLGHYDAKNS-----INVQDRKTPLQDQNVRQAIGYARNV----
3drhA           QYKQVKNLKGYKVLGQQAMYISLMYYN-----LGHYDAKNSINVQDRKTPLQDQNVRQAIGYARNV----
3drjA           YKQVK-NLKGYKVLGQQAMYISLMYYNLGHYDAKNS-----INVQDRKTPLQDQNVRQAIGYARNVAEVD
2d5wA           PQLVRRAPGRFDIWFVPGAIWEHIDINKFENCQVVKDLGLN-----------DKRTRQAILHALNR----
3drfA           YKQVKNLKGYKVLGQQAMYISLMYYNLGHYDAKNS------INVQDRKTPLQDQNVRQAIGYARNV----
3c18A           ----------------------------------------------------------------------
3c18B           ----------------------------------------------------------------------
2d05A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXX
1b0hA           -----DIIVNKVKNQGDLPAYSYTPPY----------TDGAKLVEPE---WFKWSQQKRNEEAKKLLAEA
1dpeA           --------IKAVYQGAGVSAKNLIPPTMWGYN------------------DDVQDYTYDP-------EKA
3dp8C           DNALY--GTQQVADTLFAPSVPYANLGLKPSQYDPQKAKALLEKAGWTLPAGKDIREKN-----------
3dp8B           DNALYGTQ---QVADTLFAPSVPYANLGLKPQYDPQKAKALLEKAGWTLPAGK-----------------
1dppA           --------IKAVYQGAGVSAKNLIPPTMWGYN------------------DDVQDYTYDP-------EKA
3dp8A           DNALY--GTQQVADTLFAPSVPYANLGLKPSQYDPQKAKALLEKAGWTLPAGKDIREKN-----------
1b52A           -----DIIVNKVKNQGDLP--------------------AYSYTPPYTDGAKLVEPEWFKWSQQKRNEEA
3e3kB           DNALY--GTQQVADTLFAPSVPYANLGLKPSQYDPQKAKALLEKAGWTLPAGKDIREKN-----------
3drgA           -----AEVDNKFSNGLSTPNSLIPPIFKQFTSSSVKGYEKQDLDKANKLLDEDGWKLNK-----------
3drhA           -----AEVDNKFSNGLSTP---------------ANSLIPPIFKQFTSSSVKGYEKQDLDKANKLLDEDG
3drjA           NKFSNGLS---TPANSLIPPIFKQFTSSSVKGYEKQDLDKANKLLDEDGWKLNKS---------------
2d5wA           -----EGLVKAFFDGLQPVAHTWIAPV----------NPLFNPNVKKYEFDLKKAEALLAEMGWRKGPDG
3drfA           -----AEVDNKFSNGLSTPNSLIPPIFKQFTSSSVKGYEKQDLDKANKLLDEDGWKLNK-----------
3c18A           ----------------------------------------------------------------------
3c18B           ----------------------------------------------------------------------
2d05A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQ
1b0hA           ---------GFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKT------FLDTRHQ
1dpeA           KALLKEAGLEKGFSIDLWAMPVQRPYNPNARRMAEMIQADWAKVGVQAKIVTYEWGEYL------KRAKD
3dp8C           -------GQPLRIELSFIGTDALSKSMA------EIIQADMRQIGADVSLIGEEESS------IYARQRD
3dp8B           -------DIREKNGQPLRIELSFIGTDALSKSMAEIIQADMRQIGADVSLIGEEESSIY------ARQRD
1dppA           KALLKEAGLEKGFSIDLWAMPVQRPYNPNARRMAEMIQADWAKVGVQAKIVTYEWGEYL------KRAKD
3dp8A           -------GQPLRIELSFIGTDALSKSMA------EIIQADMRQIGADVSLIGEEESSIY------ARQRD
1b52A           KKLLAEAGFTAPLTFDLLYNTSDLHKKLAIAVASIW----KKNLGVNVNLENQEWKT------FLDTRHQ
3e3kB           -------GQPLRIELSFIGTDALSKSMA------EIIQADMRQIGADVSLIGEEESS------IYARQRD
3drgA           -----STGYREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIGVKVSLYNGKLME------FNSWVDH
3drhA           WKLNKSTGYREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIGVKVSLYNGKLME------FNSWVDH
3drjA           ------TGYREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIGVKVSLYNGKLME------FNSWVDH
2d5wA           ILQRTVNGRTVRFEIEYVTTAGNVVRERTQQFFAEDLKKI----GIAVKINNAPSAVVFADEFIQRASEC
3drfA           -----STGYREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIGVKVSLYNGKLME------FNSWVDH
3c18A           ----------------------------------------------------------------------
3c18B           ----------------------------------------------------------------------
2d05A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKR
1b0hA           GTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPA--------------FDKLIADTLKVADDTQR
1dpeA           GEHQTVMMGWTGDNGDPDNFFATESCAASEQGSNYS---KWCYKP--------FEDLIQPARATDDHNKR
3dp8C           GRFGMIFHRTWGAPYDPHAFLSSMRVPSHA--DFQAQQGLADKPL--------IDKEIGEVLATHDETQR
3dp8B           GRFGMIFHRTWGAPYDPHAFLSSMRVPSHA--------DFQAQQ--GLADKPLIDKEIGEVLATHDETQR
1dppA           GEHQTVMMGWTGDNGDPDNFFATLFSCAASEQGS--NYSKWCYKP--------FEDLIQPARATDDHNKR
3dp8A           GRFGMIFHRTWGAPYDPHAFLSSMRVPSHA--------DFQAQQ--GLADKPLIDKEIGEVLATHDETQR
1b52A           GTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPA--------------FDKLIADTLKVADDTQR
3e3kB           GRFGMIFHRTWGAPYDPHAFLSSMRVPSHA--------DFQAQQ--GLADKPLIDKEIGEVLATHDETQR
3drgA           MTTPPGANDWDITDGSWSLASEPSQQDLFS--AAAPYNFGHFNDSE-------ITKDLNDSAKSENPTYR
3drhA           MTTPPGANDWDITDGSWSLASEPSQQDL---------FSAAAPYNFGHFNDSEITKDLNDSAKSENPTYR
3drjA           MTTPPGANDWDITDGSWSLASEPSQQDLFS--AAAPYNFGHFNDSE-------ITKDLNDSAKSENPTYR
2d5wA           KWTGMFEFAWVSNLQEDGSLFQYKNLNTGAIMVPTKENNYQGQNIGG-WRNDEFDRLTSQAVLEFDPERR
3drfA           MTTPPGANDWDITDGSWSLASEPSQQDL---------FSAAAPYNFGHFNDSEITKDLNDSAKSENPTYR
3c18A           ----------------------------------------------------------------------
3c18B           ----------------------------------------------------------------------
2d05A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           YEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0hA           SELYAKAEQQLDKDSAIVP---------------------------------------------------
1dpeA           VELYKQAQVVMHDQAPALI---------------------------------------------------
3dp8C           QALYRDILTRLHDEAVYLP---------------------------------------------------
3dp8B           QALYRDILTRLHDEAVYLP---------------------------------------------------
1dppA           VELYKQAQVVMHDQAPALI---------------------------------------------------
3dp8A           QALYRDILTRLHDEAVYLP---------------------------------------------------
1b52A           SELYAKAEQQLDKDSAIVP---------------------------------------------------
3e3kB           QALYRDILTRLHDEAVYLP---------------------------------------------------
3drgA           KAAFVKYQEDMNKKAYVIPTNFMLNYTPVNKRV-------------------------------------
3drhA           KAAFVKYQEDMNKKAYVIP---------------------------------------------------
3drjA           KAAFVKYQEDMNKKAYVIP---------------------------------------------------
2d5wA           KQLFWRAQEIWAEELPALP---------------------------------------------------
3drfA           KAAFVKYQEDMNKKAYVIP---------------------------------------------------
3c18A           ----------------------------------------------------------------------
3c18B           ----------------------------------------------------------------------
2d05A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxx
1b0hA           ----------------------
1dpeA           ----------------------
3dp8C           ----------------------
3dp8B           ----------------------
1dppA           ----------------------
3dp8A           ----------------------
1b52A           ----------------------
3e3kB           ----------------------
3drgA           ----------------------
3drhA           ----------------------
3drjA           ----------------------
2d5wA           ----------------------
3drfA           ----------------------
3c18A           ----------------------
3c18B           ----------------------
2d05A           ----------------------