[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56471.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d5wA.bssp"
#ERROR : Can't open dsspfile "3drjA.bssp"
#ERROR : Can't open dsspfile "3drgA.bssp"
#ERROR : Can't open dsspfile "1dpeA.bssp"
#ERROR : Can't open dsspfile "1b0hA.bssp"
#ERROR : Can't open dsspfile "1b52A.bssp"
#ERROR : Can't open dsspfile "3drfA.bssp"
#ERROR : Can't open dsspfile "3dp8A.bssp"
#ERROR : Can't open dsspfile "3drhA.bssp"
#ERROR : Can't open dsspfile "3dp8C.bssp"
#ERROR : Can't open dsspfile "3e3kB.bssp"

## Summary of PDB Search
:234
    2e-05  19%  2d5wA  [x.x.x] PEPTIDE ABC TRANSPORTER, PEPTIDE-BINDING PROTEIN
    2e-05  15%  3drjA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    7e-05  15%  3drgA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    2e-04  20%  1dpeA  [x.x.x] DIPEPTIDE-BINDING PROTEIN
    2e-04  17%  1b0hA  [c.94.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    2e-04  26%  1b52A  [c.94.1] PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
    2e-04  11%  3drfA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    3e-04  14%  3dp8A  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-04  15%  3drhA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    4e-04  15%  3dp8C  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    6e-04  14%  3e3kB  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
:234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxACGKTDKEADAPTTFSYVYAVDPASLGYSIATRTSTTDVIGNVIDGLMENDKYGNVAPSQ
2d5wA           -----------------------------------------------------------ADEFIQRASEC
3drjA           ---------------------------------------------------------------------H
3drgA           ---------------------------------------------------------------------H
1dpeA           ---------------------------------------------------------------------D
1b0hA           ----------ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSP--
1b52A           ----------ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSP-Q
3drfA           ---------------------------------------------------------------------H
3dp8A           ----------------------------------------------------------------------
3drhA           ---------------------------------------------------------------------H
3dp8C           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDYDLNSTGWAPSYQDPASYLNIMDPKSGSAMKHLGITKGKDKDVVAKPGLDKYKKLLEDAVSETTDLEK
2d5wA           KWTGMFEFAWVSNLQEDGSLFQYKNLNTG-AIMVPTKENNYQGQNIGGWRNDEFDRLTSQAVLE-FDPER
3drjA           MTTPPGANDWDITDGSWSLASEPSQQDLFSAAAPYNFGHFNDSE---------ITKDLNDIDSKSENPTY
3drgA           MTTPPGANDWDITDGSWSLASEPSQQDLFSAAAPYNFGHFNDSE---------ITKDLNDIDSKSENPTY
1dpeA           GEHQTVMMGWTGDNGDPDNFFATEFSCAA----------SEQGSNYSKWCYKPFEDLIQPARA-TDDHNK
1b0hA           ----------------------------------------------------------------------
1b52A           GTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAH-----------YKSPAFDK----LIADTLKVADDTQ
3drfA           MTTPPGANDWDITDGSWSLASEPS---------QQDLFSAAAPYNFGHFNDSEITKDLNDIDSKSENPTY
3dp8A           GRFGMIFHRTWGAPYDPHAFLSSMRVPSH----------ADFQAQQGLADKPLIDKEIGEVLATH-DETQ
3drhA           MTTPPGANDWDITDGSWSLASEPSQQDLFSAAAPYNFGHFNDSE---------ITKDLNDIDSKSENPTY
3dp8C           GRFGMIFHRTWGAPYDPHAFLSSM-RVPSHADFQAQQGLADKPLIDK----------EIGEVLATHDETQ
3e3kB           GRFGMIFHRTWGAPYDPHAFLSSMRVPSH----------ADFQAQQGLADKPLIDKEIGEVLAT-HDETQ


                         +         .         .         .         .         *         .:210
query           RYEKYAKAQAWSTDSSLLMPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2d5wA           RKQLFWRAQEIWAEELPALP--------------------------------------------------
3drjA           RKAAFVKYQEDMNKKAYVIP--------------------------------------------------
3drgA           RKAAFVKYQEDMNKKAYVIP--------------------------------------------------
1dpeA           RVELYKQAQVVMHDQAPALI--------------------------------------------------
1b0hA           ----------------------------------------------------------------------
1b52A           RSELYAKAEQQLDKDSAIVP--------------------------------------------------
3drfA           RKAAFVKYQEDMNKKAYVIP--------------------------------------------------
3dp8A           RQALYRDILTRLHDEAVYLP--------------------------------------------------
3drhA           RKAAFVKYQEDMNKKAYVIP--------------------------------------------------
3dp8C           RQALYRDILTRLHDEAVYLP--------------------------------------------------
3e3kB           RQALYRDILTRLHDEAVYLP--------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxx
2d5wA           ------------------------
3drjA           ------------------------
3drgA           ------------------------
1dpeA           ------------------------
1b0hA           ------------------------
1b52A           ------------------------
3drfA           ------------------------
3dp8A           ------------------------
3drhA           ------------------------
3dp8C           ------------------------
3e3kB           ------------------------