[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56614.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2djpA.bssp"
#ERROR : Can't open dsspfile "1e01A.bssp"

## Summary of PDB Search
:195
    2e-11  20%  2djpA  [x.x.x] HYPOTHETICAL PROTEIN SB145
    2e-09  29%  1e01A  [d.7.1 (1e0gA)] MEMBRANE-BOUND LYTIC MUREIN
:195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIY
2djpA           -----------------------GCSPVRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIF
1e01A           ------------------------------DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNS--DTANLQ


                         .         .         *         .         .         .         .:140
query           VDQELVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2djpA           LKKTLYI---------------------------------------------------------------
1e01A           PGDKLTL---------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2djpA           -------------------------------------------------------
1e01A           -------------------------------------------------------