[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56666.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2df4B.bssp"
#ERROR : Can't open dsspfile "2dqnB.bssp"
#ERROR : Can't open dsspfile "2d6fC.bssp"
#ERROR : Can't open dsspfile "1cvrA.bssp"
#ERROR : Can't open dsspfile "2d6fD.bssp"
#ERROR : Can't open dsspfile "3d7qB.bssp"
#ERROR : Can't open dsspfile "1e1cB.bssp"

## Summary of PDB Search
:480
    e-172  66%  2df4B  [x.x.x] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    e-165  65%  2dqnB  [x.x.x] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    6e-80  18%  2d6fC  [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    2e-54  10%  1cvrA  [c.17.1 - b.1.18] GINGIPAIN R
    3e-48  18%  2d6fD  [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    2e-24  12%  3d7qB  [x.x.x] XISI PROTEIN-LIKE
    1e-11  10%  1e1cB  [c.1.19 - c.23.6] METHYLMALONYL-COA MUTASE BETA CHAIN
:480

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
2df4B           -HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
2dqnB           --FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
2d6fC           -KVGLKMGLEIHQQLDTESKLFCPCRTELTDSYHEETCLVEADEEPPHPL-NPEALEIAVTIALLLNMRV
1cvrA           -------------------------------------VAEDIASPVTANAIQQFVKQEYEKEGNDLTYVL
2d6fD           -KVGLKMGLEIHQQLDTESKLFCPCRTELTDSEHEETCLVEADEEPPHPL-NPEALEIAVTIALLLNMRV
3d7qB           -------------------------------------------------KVRQLLTKHLQYKPS--YGDV
1e1cB           ---KVLNRGRPPEKQLTFAECLKRLTVHDGIDIVPKDAPKKLGYPGVAPFTRGTTVRNGDMDAWDVRALH


                         .         .         *         .         .         .         .:140
query           HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
2df4B           ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
2dqnB           ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGET-KRIGITRLHMEEDAGKSTHK-GEYSL
2d6fC           VDEFHTMRKQVIDGSNTGGFQRTGL---VATDGHLETP-----QGTVKIENLCLEEDAARRIRETGDGVV
1cvrA           LVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESEDLKTQIDRTIHYERNTTEDKWLGQAL
2d6fD           VDEFHTMRKQVIDGSNTGGFQRTGLVATDGH---LETP-----QGTVKIENLCLEEDAARRIRETGDGVV
3d7qB           EVEQIFDEEHDHYQIISVGWNNQH---RIYGPIHLDIK-----NNKIWIQQNTTEADIALELEG-IDKQD
1e1cB           EDPDEKFTRKAILEGLERGVTSLLLRVDPDAIAPEHL---DEVLSDVLLEMTKVEVFSRYDQGSDKPAKD


                         +         .         .         .         .         *         .:210
query           VDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTK
2df4B           VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTK
2dqnB           VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTK
2d6fC           FRLDRLGIPLVEITTDPSMSDPQQLREVAYQIGQILRSTRV---KRGLGTIRQDLNISIR------DGAR
1cvrA           CIASAEGGPSADNGESDIQHENVINLLTQYGYTKIIKCYKNIIDAFNGGISLVNYTGHGSETAGTSHFGT
2d6fD           FRLDRLGIPLVEITTDPSMSDPQQLREVAYQIGQILRSTRV---KRGLGTIRQDLNISIRDGAR------
3d7qB           IVIGF---------HTPKRQLSGFAV--------------------------------------------
1e1cB           LALNLGLDPIGFAALEPDLTVLGDWVRRLAKFSPDSRAVTIDANIYHNAGAGDVAELAWALATGAEY---


                         .         .         .         +         .         .         .:280
query           TELKNLNSFSNVRKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDXPLF
2df4B           AELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPL
2dqnB           AELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPL
2d6fC           VEVKGVQDLDLIPEIVEREVKRQLSLVEIRDTLQERGAVVEDADTESRIISSAESVLAVKLRGFDGLIGV
1cvrA           THVKQLTNSNQLPFIFDPCFAEALMRAQKDGKPTGTVAIIASDQYWAPPMRGQDEMNEILCEKHPNNI--
2d6fD           VEVKGVQDLDLIPEIVEREVKRQLSLVEIRDTLQERGAVVEFADTESRIISSAESVLAVKLRGFDGLIGV
3d7qB           ----------------------------------------------------------------------
1e1cB           -----VRALVEQGFTATEAFDTINFRVTATHDQFLTIAR-------------------------------


                         .         *         .         .         .         .         +:350
query           EIXDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAKQVSNWLQGEV
2df4B           YIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGV
2dqnB           YIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGV
2d6fC           EIQPGR--RLGTEMADYAKKRGVSGIFHTGITEEEVRGLRDAVGASQGDA--VVMVAHERVTAENALREV
1cvrA           ----------------------KRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVF-GDPSLLVRTLVPTE
2d6fD           EIQPGR--RLGTEMADYAKKRGVSGIFAYGITEEEVRGLRDAVGASQGDA--VVMVAHERVTAENALREV
3d7qB           ----------------------------------------------------------------------
1e1cB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAIL
2df4B           NEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNA------------------
2dqnB           NEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIME-------------
2d6fC           IRRAEMAIQGVPEETRKALPDGNIPLFRIEDDLLEGIRRNLPELPSEK---KERIMRDYG---LSEDLAS
1cvrA           MQVTAPANISASAFEVACDYNGAIATLSDDGDMVGGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKV
2d6fD           IRRAEMAIQGVPEETRKASSRMYLETDIPLFRIEDDLLEGIRRNLPELPSKKERIMRDYGLVDEFDTTVI
3d7qB           ----------------------------------------------------------------------
1e1cB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IPIIHQVFADNEAAVVDFKSGKRNADKAFTGFLMKATKGQANPQxxxxxxxxxxxxxxxx
2df4B           ------------------------------------------------------------
2dqnB           ------------------------------------------------------------
2d6fC           QLVKRNLVDEFDTTVIASLLAYTLRE----------------------------------
1cvrA           ------------------------------------------------------------
2d6fD           ASLLAYTLRELRREGHDVDGLG---LDELRDAIKLLEVGKISKD----------------
3d7qB           ------------------------------------------------------------
1e1cB           ------------------------------------------------------------