[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56676.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e6gA.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "2ctzA.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"
#ERROR : Can't open dsspfile "3cogD.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1cl1B.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "3d19B.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "1ddzA.bssp"
#ERROR : Can't open dsspfile "3d19C.bssp"
#ERROR : Can't open dsspfile "3d19D.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "1e5eA.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"
#ERROR : Can't open dsspfile "1ejiA.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "1eg5B.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "3ecdB.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "3bwnA.bssp"
#ERROR : Can't open dsspfile "2dkjA.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1ecxB.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "1c7gA.bssp"
#ERROR : Can't open dsspfile "3e9kA.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "1eg5A.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "3bwnD.bssp"
#ERROR : Can't open dsspfile "3bcbA.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "3bcaA.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "2a7vA.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "2ch1A.bssp"
#ERROR : Can't open dsspfile "2dr1A.bssp"
#ERROR : Can't open dsspfile "2ch2A.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "2dgkA.bssp"
#ERROR : Can't open dsspfile "3bc8A.bssp"
#ERROR : Can't open dsspfile "2dgmB.bssp"
#ERROR : Can't open dsspfile "3d19E.bssp"
#ERROR : Can't open dsspfile "2bwnD.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "3d19A.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "3e77C.bssp"
#ERROR : Can't open dsspfile "2bwnB.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "2bwnA.bssp"
#ERROR : Can't open dsspfile "3bwnB.bssp"
#ERROR : Can't open dsspfile "3bwoC.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "3bwnF.bssp"
#ERROR : Can't open dsspfile "2dgkC.bssp"
#ERROR : Can't open dsspfile "2bwoB.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "1dfoB.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "2dr1B.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "1djpA.bssp"
#ERROR : Can't open dsspfile "2c44B.bssp"
#ERROR : Can't open dsspfile "3e77A.bssp"
#ERROR : Can't open dsspfile "3caiA.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "2bwoA.bssp"
#ERROR : Can't open dsspfile "2e7jA.bssp"
#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "2bkwA.bssp"
#ERROR : Can't open dsspfile "3bwoA.bssp"
#ERROR : Can't open dsspfile "2c44C.bssp"
#ERROR : Can't open dsspfile "3e77B.bssp"
#ERROR : Can't open dsspfile "1eghA.bssp"
#ERROR : Can't open dsspfile "2c44A.bssp"
#ERROR : Can't open dsspfile "1b93B.bssp"
#ERROR : Can't open dsspfile "2bwnE.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "2btwB.bssp"
#ERROR : Can't open dsspfile "2btwA.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "1ajsA.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "1cj0A.bssp"
#ERROR : Can't open dsspfile "1ay4B.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "3d46A.bssp"
#ERROR : Can't open dsspfile "1cj0B.bssp"
#ERROR : Can't open dsspfile "1e9yA.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "3bwnE.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "2bieB.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "3bh1D.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "1bw9A.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "1c1dA.bssp"

## Summary of PDB Search
:364
    2e-97  40%  3e6gA  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    6e-67  40%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    1e-59  40%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    2e-49  29%  2ctzA  [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
    3e-45  30%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
    1e-43  38%  3cogD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    7e-42  38%  1cs1A  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    2e-35  21%  1cl1B  [c.67.1] CYSTATHIONINE BETA-LYASE
    3e-34  21%  1cl1A  [c.67.1] CYSTATHIONINE BETA-LYASE
    3e-34  13%  3d19B  [x.x.x] CONSERVED METALLOPROTEIN
    1e-33  33%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    2e-33  11%  1ddzA  [c.53.2 - c.53.2] CARBONIC ANHYDRASE
    8e-33  13%  3d19C  [x.x.x] CONSERVED METALLOPROTEIN
    1e-32  12%  3d19D  [x.x.x] CONSERVED METALLOPROTEIN
    2e-32  12%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    2e-32  36%  1e5eA  [c.67.1] METHIONINE GAMMA-LYASE
    5e-32  13%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    2e-31  12%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    2e-31  12%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    3e-31  13%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    8e-31  10%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    2e-30  32%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    3e-30  14%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    4e-30  11%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-28  13%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    1e-27  10%  1ejiA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    1e-27  12%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    1e-27  13%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    1e-27  10%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-26  10%  1eg5B  [c.67.1] AMINOTRANSFERASE
    3e-26  12%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-26  14%  3ecdB  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    1e-25  14%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    2e-25  11%  3bwnA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    5e-25  12%  2dkjA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    8e-25  11%  1ecxA  [c.67.1] AMINOTRANSFERASE
    1e-24  12%  1ecxB  [c.67.1] AMINOTRANSFERASE
    1e-24  13%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    2e-24   7%  1c7gA  [c.67.1] TYROSINE PHENOL-LYASE
    2e-24  11%  3e9kA  [x.x.x] KYNURENINASE
    2e-24  12%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    3e-23  13%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    3e-23  13%  1eg5A  [c.67.1] AMINOTRANSFERASE
    4e-23   9%  1bj4A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    5e-23  12%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    1e-22  10%  3bwnD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-22   8%  3bcbA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    4e-22  13%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    6e-22  12%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
    7e-22  12%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    8e-22   9%  1c0nA  [c.67.1] PROTEIN (CSDB PROTEIN)
    8e-22  11%  3bcaA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    2e-21   8%  1ax4A  [c.67.1] TRYPTOPHANASE
    2e-21   9%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    2e-21  15%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    2e-21  10%  2a7vA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    3e-21  15%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    5e-21  10%  2ch1A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    1e-20  14%  2dr1A  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    2e-20   9%  2ch2A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    2e-20  12%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    3e-20  12%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    3e-20  10%  2dgkA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    3e-20  10%  3bc8A  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    7e-20   9%  2dgmB  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-19  11%  3d19E  [x.x.x] CONSERVED METALLOPROTEIN
    3e-19  11%  2bwnD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-19  13%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    5e-19  12%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    5e-19  11%  3d19A  [x.x.x] CONSERVED METALLOPROTEIN
    1e-18  10%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-18  11%  3e77C  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-18  10%  2bwnB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-18  10%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    3e-18  10%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    3e-18  11%  2bwnA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-18  12%  3bwnB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-17  12%  3bwoC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-17  11%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-17  10%  3bwnF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-17  10%  2dgkC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    3e-17  10%  2bwoB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-17  11%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-17  13%  1dfoB  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    5e-17  12%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    5e-17  12%  2dr1B  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    6e-17   9%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    8e-17   9%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    1e-16   9%  1djpA  [c.88.1] GLUTAMINASE-ASPARAGINASE
    2e-16  13%  2c44B  [x.x.x] TRYPTOPHANASE
    2e-16  10%  3e77A  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    3e-16  12%  3caiA  [x.x.x] POSSIBLE AMINOTRANSFERASE
    3e-16  11%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    3e-16  11%  2bwoA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-16  11%  2e7jA  [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
    5e-16  14%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    2e-15  10%  2bkwA  [x.x.x] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1
    7e-15  10%  3bwoA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    9e-15  14%  2c44C  [x.x.x] TRYPTOPHANASE
    1e-14  12%  3e77B  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-14  13%  1eghA  [c.24.1] METHYLGLYOXAL SYNTHASE
    2e-14  12%  2c44A  [x.x.x] TRYPTOPHANASE
    2e-14  13%  1b93B  [c.24.1] PROTEIN (METHYLGLYOXAL SYNTHASE)
    2e-14  11%  2bwnE  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-12  12%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    7e-12   8%  2btwB  [x.x.x] ALR0975 PROTEIN
    1e-11   6%  2btwA  [x.x.x] ALR0975 PROTEIN
    4e-11  11%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    1e-10  10%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-10  15%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    7e-10  12%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-09  10%  1ajsA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-09  14%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    2e-09   8%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    3e-09  12%  1cj0A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    4e-09  10%  1ay4B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    4e-09  10%  1c7nA  [c.67.1] CYSTALYSIN
    5e-09  11%  1c8nA  [b.121.4] COAT PROTEIN
    1e-08  10%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    7e-08  11%  1d2fB  [c.67.1] MALY PROTEIN
    9e-08  13%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    2e-07  11%  1agxA  [x.x.x] GLUTAMINASE-ASPARAGINASE
    2e-07  12%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    7e-07   5%  3d46A  [x.x.x] PUTATIVE GALACTONATE DEHYDRATASE
    2e-06  13%  1cj0B  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    2e-06  13%  1e9yA  [d.8.1 - b.85.3] UREASE ALPHA SUBUNIT
    5e-06  13%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    9e-06  14%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    1e-05  12%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-05  12%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-05  10%  3bwnE  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-05  12%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-05   8%  2bieB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    3e-05  16%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    3e-05  11%  3bh1D  [x.x.x] UPF0371 PROTEIN DIP2346
    7e-05  13%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    9e-05   8%  1bw9A  [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE
    2e-04  12%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-04  17%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-04  16%  1bs0A  [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    7e-04  10%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    8e-04   8%  1c1dA  [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKELHINTILAQAGIKSDEATGALVTPLHFSTTYQHPEFGRSTGFDYTRTKNPTRSKAEEVLATIESAD
3e6gA           ----LSLATLAIHGGQSPDPSTGAVMPPIYATSTYA-----------QSSTHNPTRFAYERCVAALEGGT
3e6gB           ---------------------------------------LSLATLAIHGGTHNPTRFAYERCVAALEGGT
3e6gD           -------------------------------------------ATLAIHGTHNPTRFAYERCVAALEGGT
2ctzA           ----MRFETLQLHAGYEPEPTTLSRQVPIYPTTSYVFKSALKEFGNIYSRIMNPTVDVLEKRLAALEGGK
2cb1A           ----MEYTTLAVLAGLPEDP-HGAVGLPIYAVAAYGFKTFATGEGYVYARQKDPTAKALEERLKALEGAL
3cogD           LPHFQHFATQAIHVGQDPEQWTRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAK
1cs1A           -----KQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEGGA
1cl1B           -----KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVRANGELFYGRRGTLTHFSLQQAMCELEGGA
1cl1A           ------LDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVRANGELFYGRRGTLTHFSLQQAMCELEGGA
3d19B           ------------------------------------------------TSVMFVERSLNE---IRF----
3cogB           LPHFQHFATQAIHVGQDPEQWTRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAK
1ddzA           MSD-LEKKFIELEAKLVAQPAGQAMPGKSNIFANNEANRLANGQSPEYLWIGCADSRVPANQLLDLPAGE
3d19C           ----------------------------------------------------------------------
3d19D           ----------------------------------------------------------------------
3bn1D           ---------------------------------SVAAPRLLECMDTTWISSVGRFIVEFEKAFADYCGVK
1e5eA           --ERMTPATACIHANPQKDQ-FGAAIPPIYQTSTFVFDNAGQESGYIYTRLGNPTVSNLEGKIAFLEKTE
2c7tA           --------------------------------------QSNRWAISGYWTGEESMERKFAKAFADFNGVP
2c81A           --------------------------------------QSNRWAISGYWTGEESMERKFAKAFADFNGVP
3ecdA           -----------ILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGADEVEALAIERVKRLFNAG
3ecdD           -----------------------------SQVELIASENIVSQGSVLTNKYADEVEALAIERVKRLFNAG
3dr7B           ---------------------------------SVAAPRLLECMDTTWISSVGRFIVEFEKAFADYCGVK
1e5eB           --ERMTPATACIHANPQKDQ-FGAAIPPIYQTSTFVFDNCGQESGYIYTRLGNPTVSNLEGKIAFLEKTE
3bcxA           ------------------PFEAGKSVVPPSGKVIGTELQLMVEASLDGWLTTGRFNDAFEKKLGEYLGVP
3dr4B           ------------------------------------APRLLECMDTTWISSVGRFIVEFEKAFADYCGVK
3ecdC           -----------ILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYDEVEALAIERVKRLFNAG
1ejiA           --RQRVGLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGEFIDELELCQKRALQAYHLDPQCWG
3bn1C           ------------------------------------APRLLECMDTTWISSVGRFIVEFEKAFADYCGVK
3bcxB           ----------------------------------PSGKVIGVEASLDGWLTTGRFNDAFEKKLGEYLGVP
3dr4D           ---------------------------------SVAAPRLLECMDTTWISSVGRFIVEFEKAFADYCGVK
1eg5B           -------------------------------ATTRVDDRVYGNPNSAHGGIEANLHEKAREKVAKVLGVS
3dr4A           ---------------------------------SVAAPRLLECMDTTWISSVGRFIVEFEKAFADYCGVK
3ecdB           -----------------------------------DAQGSVLTNKYAEGYADEVEALAIERVKRLFNAGH
3bb8A           ------------------PFEAGKSVVPPSGKVIGTELQLMVEASLDGWLTTGRFNDAFEKKLGEYLGVP
3bwnA           ------------------------------DRCTVTIRGCDLMSYFDMTNLCWFLEPELEDAIKDLHGVV
2dkjA           ---------------IALEEKRQREGLELIASENFVSKQYPGARYYGGCEVIDRVESLAIERAKALFGAA
1ecxA           -----------------------------NNATTRVDDRGNPNSAHGMGIEANLHMEKAREKVAKVLGVS
1ecxB           ------------------------------------------NSAHGMGIEANLHMEKAREKVAKVLGVS
1b9hA           -------------------------------------------EQGQWWRMGGDEVNSFEREFAAHHGAA
1c7gA           ------------------LLNSKDIYIDLSGTNAMSDKQWAGMMIGDEAYAGSENFYHLEKTVKELFGFK
3e9kA           --------------------------------ELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGAN
3bn1A           -------------------------LPRISVA----APRLDECMDTTWISSVGRFIVEFEKAFADYCGVK
3dr4C           -------------------------LPRISVA----APRLDECMDTTWISSVGRFIVEFEKAFADYCGVK
1eg5A           -------------------------------ATTRVDDRVYGNPNSAHGGIEANLHEKAREKVAKVLGVS
1bj4A           -----------------------AVLEALGCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLD
2cy8A           ------------------------------------HPRVALSHGVQYAASHPLEVRWAERIVAAFPSIR
3bwnD           -----------------------------------IRGCDLMSYFSDMTNLCWFLEPELEDAIKDLHGVV
3bcbA           ------------------------------------GDISAVQPKAAGSSLLNKITNSLVLNVIKLAGVH
2aeuA           ----LRLEKARKIIL---EILNEKGRDALYLSGLSGGFLIDKALLNTYIGSSYFAEKVNEYGLKHLGGDE
1c4kA           ------------------------------------------DVALGDLLIHEGPAVAAEKHAARVYNAD
2cfbA           ------------------------------------------EKGTSFGAPCLLENILAEMVIAAVPSVE
1c0nA           -------SVDAVRADFPVLSREVNGLPLAYLDSAQKPSQAVHAGAHTLSAQATEKMENVRKRASLFINAR
3bcaA           LHELAVMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGQPKAAGSSLLNKITNSLVLNVIKLAGVH
1ax4A           -----------------------------SGTNAMSDHQWAAMITGDEAYAGSRNYYDLKDKAKELFNYD
2dgmE           ------QNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLADLWHAPAPKNGQAVGTNTIGSS
3b8xB           -----------------------------------------------KMFTMGEYVKQYETQFAKTFGSK
2a7vA           -----------------------------------------------RGLELIASENFCSRAALEALGSC
3b8xA           ------------------------------------SSTWIQSVLDSKMFTMGEYVKQYETQFAKTFGSK
2ch1A           ------------------NPLIIPEKIMMGPGPSNCSKRVTNTVLSNFHAELFRTMDEVKDGLRYIENRA
2dr1A           ---------------------------LFTAGPVACFPEMFSHRSKEYRKVHMDTVERLREFLEV-EKGE
2ch2A           ------------------NPLIIPEKIMMGPGPSNCSKRVTNTVLSNFHAELFRTMDEVKDGLRYIENRA
2aevA           -----KARKIILEI------LNEKGRDALYDLSGLSGGFLIDEKDKAYIGSSYFAEKVNEYGLKHLGGDE
3dc1D           --------------------------------LQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQM
2dgkA           -----------------------------------------------ADLWHAPAPKNGQAVGTNTIGSS
3bc8A           ----------------------------------------GRQPKAAGSSLLNKITNSLVLNVIKLAGVH
2dgmB           ------------------KLMDLSINKNWIDKEEYPQSAAIDLRNMVADLWHAPAPKNGQAVGTNTIGSS
3d19E           ----------------------------------------------------------------------
2bwnD           ------------------------------------------SGGTRNISGTTAYHRRLEAEIAGLHQKE
1b9iA           -------------------------------------------EQGQWWRMGGDEVNSFEREFAAHHGAA
1b8gB           -----------------------------------FAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFD
3d19A           -----------------------------------------------VTSVMFVERSLNEIRFWS-----
2dgmA           -----------------------------------------------ADLWHAPAPKNGQAVGTNTIGSS
3e77C           ------------------------------YKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYK
2bwnB           -------------------------------------------GGTRNISGTTAYHRRLEAEIAGLHQKE
3dc1B           ---------------ITVENGKTIQFGEEMMKLQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQM
3b46A           -------------------------------------------PTRGRPSLINSLIKLYSPIYNTELKAE
2bwnA           --------------------------------------------GTRNISGTTAYHRRLEAEIAGLHQKE
3bwnB           -----------------------TAYEEYWRKMGDIRGCDLMSYFSDMTNLCWFLEPELEDAIKDLHGVV
3bwoC           ---------------------------------------DLMSYFSDMTNLCWFLEPELEDAIKDLHGVV
2bwoD           --------------------------DYLGMGQHPVVLAGAGSGGTRNISGTTAYHRRLEAEIAGLHQKE
3bwnF           ----------------------------------GCDLMSYFSDMTNLCWFLEPE---LEDAIKDLHGVV
2dgkC           --------------------------------------------NMVADLWHAPAPKNGQAVGTNTIGSS
2bwoB           -------------------------------------------GGTRNISGTTAYHRRLEAEIAGLHQKE
2bwpA           ------------------------------------------SGGTRNISGTTAYHRRLEAEIAGLHQKE
1dfoB           -----------------------------SQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGAD
3dydA           ------------------TVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYHCPEEAK
2dr1B           --------------------MVKPKYKLFTAGPVACFPEMFSHRSKEYRKVHMDTVERLREFLEV-EKGE
2dgmC           -----------------------------------------------ADLWHAPAPKNGQAVGTNTIGSS
3b46B           -----------------------------------IPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAE
1djpA           -----DVDGIVITHGTDTLEETAYFLKPIVVVGSMRPGNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSK
2c44B           --------------------------------TGAVTQSMQAAMRGDEAYSGSRSYYALAESVKNIFGYQ
3e77A           ------------------------------YKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYK
3caiA           ----------------------------------------------------------------------
1b8gA           --------IIQMGLAENQLCFDLLESWLAKNPEAAFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFD
2bwoA           ------------------------------------------SGGTRNISGTTAYHRRLEAEIAGLHQKE
2e7jA           ------------------------------------GGKLTEE-ARQALLEWPPIHDFIHNQLPKFLGCD
2e54A           ----MYLMNTYSRFPATFVYGKGSWIYDLDFSGIAVNVLGAEKLIHCSNLFWNRPQMELAELLSKNTFGG
2bkwA           -----------------------------------------GHTSPEFVSIFQRVLKNTRAVFKSAAASK
3bwoA           ----------------------------------------------DMTNLCWFLEPELEDAIKDLHGVV
2c44C           --------------------------------TGAVTQSMQAAMRGDEAYSGSRSYYALAESVKNIFGYQ
3e77B           ------------------------------YKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYK
1eghA           --------------------------------------------------------------LTTRTLPA
2c44A           --------------------------------TGAVTQSMQAAMRGDEAYSGSRSYYALAESVKNIFGYQ
1b93B           -------------------------------------------------------------ELTTRTLPA
2bwnE           ------------------------------------------SGGTRNISGTTAYHRRLEAEIAGLHQKE
3cq5A           --------------------NTNENPYPPSEALVADLVATVDKIATELNRYPERDAVELRDELAAYITKQ
2btwB           --------------------------------------------------------------------SP
2btwA           ----------------------------------------------------------------------
3dzzB           -------------GNSIKWGVLKEKELPWIAEDFKIAPEIASVAAFGYESVPAEYYKAVADWEEIERPKE
1bjwA           ------------------ALTAGEPDFDTPARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPE
2bwpB           ------------------------------------------SGGTRNISGTTAYHRRLEAEIAGLHQKE
3bs8A           ----------------------------------------------------------AKLVIDRVPSVE
1ajsA           -------------------KVEQRIANNSSLNHEYLPAEF-RTCASRLALGDDSPALQEKRVGGVQSLGG
1djuB           -------------------------------------------THYGPNIGLLELREAIAEKLKKQNGIE
3bh1C           ----------------------------------------------------------------------
1cj0A           ----------------------------------------------------------LQAYGLDPQCWG
1ay4B           --------------------------------------------ETTKTYAGLSGEPEFQKAMGELILGD
1c7nA           -----------------------------------YLDETVLGYTGPTEEYKKTVKKWMKDRHQWDIQTD
1c8nA           ----------------------------------------------------NSTVVSNSELILNL----
1dtyA           -----------------------------LVAMTPQPLECVFLADSGSVAVEVAMKMALQYWDAKGEARD
1d2fB           ------------------------------------------YSRWKNDEFLAAIAHWFSTQHYTAIDSQ
1djuA           -------------------------------------------THYGPNIGLLELREAIAEKLKKQDPKT
1agxA           NLVVHTDKPIVLVGSMRPSTALSADGPLNLYSAVALASSNEA-KNKGVMVLMNDSIFAARDVTKGINIHT
2eh6A           -----------------------------------------KLLHVSNLYENPWQEELAHKLVKHFWTEG
3d46A           ----------------------------------------PTHWGP-HDGDAGIRKDA-AMVADMREKCG
1cj0B           ----------------------------------------------------------LQAYGLDPQCWG
1e9yA           -------------------------------------------------LDKLMLHYAGELAKKRKEKGI
3ei9A           -----------------------------------ELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIG
2egyD           -----------------------------------------------LQYSPTEGYAPLRAFVAEWIGVR
3ei9B           ------------------------------------LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIG
3ei7B           -----------------------------------ELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIG
3bwnE           -----WRKMGDRCTVTIRGCDLMSYFSDMTNLCWFLEPEL-EDAIKDLHGVVGNAATEDRYIVVGT-GST
3eiaB           -----------------------------------ELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGDD
2bieB           -----------------------------------------------YEEVHEQAQNLLRELLQIPNDYQ
2egyB           ----------------------------------------------------TEGYAPLRAFVAEWIGPE
3bh1D           ----------------------------------------------------------------------
3ei6B           ------------------TEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIG
1bw9A           ----------------------------------------------------------------------
3ei7A           --------------------------------------------------------------------DD
3cbfA           --------------------------------------------------------------------PE
1bs0A           -----------------------------------------------------------EEELAEWLGYS
3e2fA           ----------------------------------------------------------------QIDPNE
1c1dA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YALATSSGMSAIVLAFSGFPVGSKVLAVRDLYGGSFRWFNQVEQEGRFHFTYANTEEELIAELEKDVDVL
3e6gA           RAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAFSFVDLTDPAAFKAAIRADTKMV
3e6gB           RAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAFSFVDLTDPAAFKAAIRADTKMV
3e6gD           RAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAFSFVDLTDPAAFKAAIRADTKMV
2ctzA           AALATASGHAAQFLALTTLAAGDNIVSTPNLYGGTFNQFKVTLKRLGIFTSREERPEEFLALTDEKTRAW
2cb1A           EAVVLASGQAATFAALLALP-GDEVVAAKGLFGQTIGLFGQVLSLMGVTVRYVDEPEAVREALSAKTRAV
3cogD           YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKLLEAAITPETKLV
1cs1A           GAVLTNTGMSAIHLVTTVFKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGQALRAALAEKPKLV
1cl1B           GCVLFPCGAAAVANSILAFIQGDHVLMTNTAYEPSQDFCSKILSKLGVSWFDPLIGADIVKHLQPNTKIV
1cl1A           GCVLFPCGAAAVANSIAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVSWFDPLIGADIVKHLQPNTKIV
3d19B           --WSRIMKEHSFFLRLGFRCEDTQLIEEANQF---YRLFEHIEQIAHSYTNETDPEQ--IKRFNAEVQQ-
3cogB           YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDKIKLLEAAITPETKLV
1ddzA           VCIHSDISFLSVLQYAVQLKVKHILVCGHYGCGGAKAALGDSRLGL---------IDNWLRHIRDVRRMN
3d19C           -------KEHSFFLRLGFRCEDTQLIEEANQF---YRLFEHIEQIAHSYTNETDPEQ--IKRFNAEVQQ-
3d19D           ------MKEHSFFLRLGFRCEDTQLIEEANQF---YRLFEHIEQIAHSYTNETDPEQ--IKRFNAEVQQ-
3bn1D           HAIACNNGTTALHLALVAMGIGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALIPRT
1e5eA           ACVATSSGMGAIAATVLTILKGDHLISDECLYGCTHALFEHALTKFGIDFINTAIPGEVKKHMKPNTKIV
2c7tA           YCVPTTSGSTAMLALEALGIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVDTYCIDPQLIKSAITDKT
2c81A           YCVPTTSGSTAMLALEALGIGEGDEVIVPSLTWIATATAVLNALPVFVDVEADTYCIDPQLIKSAITDKT
3ecdA           HANVQPHSGAQANGAVALAKPGDTVLGMSLFNALQYGVS---------RDTMLIDYDQVEALAQQHKPSL
3ecdD           HANVQPHSGAQANGAVALAKPGDTVLGMSLFNALQYGVSRD---------TMLIDYDQVEALAQQHKPSL
3dr7B           HAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVFNLDAAKLEALITPRTKAI
1e5eB           ACVATSSGMGAIAATVLTILKAGDHLISDECLYGCTHAFEHALTKFGIDFINTAIPGEVKKHMKPNTKIV
3bcxA           YVLTTTSGSSANLLALTALTSGDEVITVAAGFPTTVNPTIQNGLIPVFDVDIPTYNVNASLIEAAVSDKT
3dr4B           HAIACNNGTTALALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALIPRT
3ecdC           HANVQPHSGAQANGAVMLALAGDTVLGMSLFNALQYGVSRDTMLI----------DYDQVEALAQQHKPS
1ejiA           VNVQPYSGSPANFAVYTAVEPHGRIGLDLPDGGHLTHGFTDKKKISATSIFFEYINYDQLEENASLFHPK
3bn1C           HAIACNNGTTALHLALVAMGIGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEPRTKAI
3bcxB           YVLTTTSGSSANLLALTALTSGDEVITVAAGFPTTVNPTIQNGLIPVDIPTYNVNASLIEAAVSDKTKAI
3dr4D           HAIACNNGTTALHLALVAMGIGPGEVIVPSLTYIASANSVTYCGATPVLVDNDPRTLDAAKLEALITPRT
1eg5B           PSFFTSCATESINWILKTVETFEKRKRTIITTPIEHKAVLEKYLSKGFKVKYVPVDSRGVVELEKLVDFL
3dr4A           HAIACNNGTTALHLALVAMGIGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALITPR
3ecdB           ANVQPHSGAQANGAVMLALAKGDTVLGMSLFNALQYGVS---------RDTMLIDYDQVEALAQQHKPSL
3bb8A           YVLTTTSGSSAPKLGVRALKPGDEVITVAAGFPTTVNPTIQNGLIPVFDVDIPTYNVNASLIEAAVSDKT
3bwnA           GNAAGTGSTQLCQAAVHALSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDA--WGFDKKGPYIE
2dkjA           WANVQPHSGSQANVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYGVRPDTELIDLEEVRRLALEH
1ecxA           PSFFTSCATESINWILKTFEKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVKLEEDTFLV
1ecxB           PSFFTSCATESINWILKTFEKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVKLEEDTFLV
1b9hA           HALAVTNGTHALALQVMGVGPGTEVIVPAFTFISSSQAAQRVDVDAA---TYNLDPEAVAAAVTPRTKVI
1c7gA           HIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRFHQASLNLPFKGDIDLNKLATLIKEKGAENIAYI
3e9kA           EKELMNALTVNLHLLMLSFPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMLEVIEKEGDSIAVI
3bn1A           HAIACNNGTTALALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLPRTFNLDAAKLEALITPRTKAI
3dr4C           HAIACNNGTTALALVAMGIGPGDEVIVPSLTYIASANSVTYPVLVDNDPRTFNLDAAKLEALITPRTKAI
1eg5A           PSFFTSCATESINWILKTVKRKRTIITTPIEHKAVLETKYLSKGFKVKYVPVDSRGVVKLEELEKLVDFL
1bj4A           PNVQPYSGSPANFAVYTALVEPHRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYIPK
2cy8A           KLRFTGSGTETTLLALRVARAFTGRRMILRFEGTTANTLL-------IRPDDIEGMREVFANHGSDIAAF
3bwnD           GNAATEDRYIVVGAVHALSSLARSQPVSVVAAAPFYSTYVEETT--YVRSGMYKWEGDAWGFDKKGPYIE
3bcbA           SVFVVPMATGMSLTLCFLTIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPEHILCL
2aeuA           NDKCGFNRTSSAILATILALKPKKVIHYLPELPGHPSIERSCKIVNAKYFESDKVGEILNKIDKDTLVII
1c4kA           KTYFVLGGSSANNTVTSALSNGDLVLFDRNNHKSVYNSALAMAGGRPVYLQTNRNPVDPERAKWKRPFRL
2cfbA           MVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHAATL----TAPYNDLEAVSRLFEQYPNDIAGV
1c0nA           SAETTEGINLVANSWGNSNRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNPTLPTLFDAATRLL
3bcaA           SVAATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVVLEGDELRTDLKAVEAKIQELGPEHILCL
1ax4A           YIIPAHQGRGAENILFPVGKAKNPVFISNFHFDTTAAHVELNGCKAINIVTEDFDIKKLKENIAQHIVAI
2dgmE           EACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQIWHKFARYWDMRPGQLFMDPKRMIEACDENTIGV
3b8xB           YAVMVSSGSTANLLMIAALKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVNTLNIDIESLKEAVTDSTKAI
2a7vA           LEGVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANDRIMGYKLNPKTGLIDYNQLALTARLFRPRL
3b8xA           YAVMVSSGSTANLLMIAALKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAVTDS
2ch1A           TMCVSGSAHAGMEAMLSNLEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEGPPDETLARAIELHPKCL
2dr1A           VLLVPSSGTGIMEASIRNGSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKPEDLPDVEAV
2ch2A           TMCVSGSAHAGMEAMLSNLEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEGPPDETLARAIELHPKCL
2aevA           NDKCVGFNRTSSAILATILALPKKVIHYLPELPGHPSIERSCKIVNAKYFESDKVGEILNKIDKDTLVII
3dc1D           DLCVTSGSQQGLCKVFEMIPAYSGTLQSLHPLGCNIINVASDESGIRDILSRWKPEDAKNPQKNTPKFLY
2dgkA           EACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFRYWDVELREIPMRPGRMIEACDENTIGV
3bc8A           SVAATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENRTDLKAVEAKIQELGPCL
2dgmB           EACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGMIEACDENTIGV
3d19E           --WSRIMKEHSFFLRLGFRCEDTQLIEEANQF---YRLFEHIEQIAHSYTNETDPEQ--IKRFNAEVQQ-
2bwnD           AALVFSSAYNANDATLSTLVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDRELIAADDPAAPKLI
1b9iA           HALAVTNGTHALALQVMGVGPGTEVIVPAFTFISSSQAAQRVDVDAA---TYNLDPEAVAAAVTPRT-KV
1b8gB           PLVLTAGATSANETFIFCLDPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGQEAEKRNLRVKGV
3d19A           ----RIMKEHSFFLRLGFRCEDTQLIEEANQFYR---LFEHIEQIAHSYTNETDPE---QIKRFNAEVQQ
2dgmA           EACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGMIEACDENTIGV
3e77C           VIFLQGGGCGQFSAVPLNLKAGRCADYVVTGAWSAAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYV
2bwnB           AALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHLRELIAADDPAAPKLI
3dc1B           DLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLY
3b46A           NVTVTTGANEGILSCLMGLPFFDQYIPNIELCGGKVVYVP-INPPKELDQEWTIDFEQFEKAITSKTKAV
2bwnA           AALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMINAGPKRIFRHNDVAHLRELIAADDPAAPKLI
3bwnB           GNAAGTGSTQLCQAAVHALSLARSQPVSVVAAAPFYSTYVEETT--YVRSGMYKWEGDAWGFDKKGPYIE
3bwoC           GNAAGTGSTQLCQAAVHALSSPVSVVAAAPFYSTYVEETTYV---RSGMYKWEGDAWGFDKK---GPYIE
2bwoD           AALVFSSAYNANDATLSTLRLFPGLIIYSDSLNHASMIEGIKRNAGPKHNDVAHLRELIAADDPAAPKLI
3bwnF           GNAAGTGSTQLCQAAVHASSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAW--GFDKKGPYIE
2dgkC           EACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIMDPKRMIEACDENTIGV
2bwoB           AALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEAGPKRIFRHNDVAHLRELIAADDPAAPKLI
2bwpA           AALVFSSAYNANDATLSTLRVLFPLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDRELIAADDPAAPKLI
1dfoB           YANVPHSGSQANFAVYTALEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGIDADLEKQAKEHKPK
3dydA           DVILTSGCSQAIDLCLAVLAPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKLKQLEYLIDEKTACL
2dr1B           VLLVPSSGTGIMEASIRNGSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKPEDLPDVEAV
2dgmC           EACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGMIEACDENTIGV
3b46B           NVTVTTGANEGILSCLMGLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPEWTIDFEQFEKAITSKTKAV
1djpA           SINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIVTDTAYKALAQNGAKAL
2c44B           YTIPTHQGRGAEQIYIPVLDRSKMVAFSNYFFDTTQGHSQINGCTVRNNFDLEGLERGIEEVGPNNVPYI
3e77A           VIFLQGGGCGQFSAVPLNLKAGRCADYVVTGAWSAAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYV
3caiA           ---------------------GYEVIVSRLDDEANIAPWLRAAHRYGAKVKWAEVDWQWESLISKSTRLV
1b8gA           PLVLTAGATSANETFIFCLPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEYQEAEKRNLRVKGV
2bwoA           AALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEAGPKRIFRHNDVAHLRELIAADDPAAPKLI
2e7jA           VARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVANIALVPKTDYPDYAITPENFAQTIEETVVLA
2e54A           KVFFANTGTEANEAAIKIAKYGKKILSAHNSFHGRTLGSLTATGQPKYQKPFEPLVEDLRRKMSEDVCAV
2bkwA           SQVLAGSGTLGWDIFASNFAPNKNVLVVSTGTFSDRFADCLRSYGAQVDVVRPLKILITEKLSQNSYGAV
3bwoA           GNAVGTGSTQLCQAAVHALLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKK---GPYIE
2c44C           YTIPTHQGRGAEQIYIPGLDRSKMVAFSNYFFDTTQGHSQIVRYDFKGNFDLEGLERGIEEVGPNNVPYI
3e77B           VIFLQGGGCGQFSAVPLNLIGGRCADYVVTGAWSAAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYV
1eghA           RKHIALVAHDHCKQMLMSWVERHQPLLEQHVLYATGTTGNLISRATGMNGPMGGDQQVGALISEGKIDLI
2c44A           YTIPTHQGRGAEQEQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNNFDLEGLERGIEEVGPNNVPYI
1b93B           RKHIALVAHDHCKQMLMSWERHQPLLEQHVLYATTGNLISRATGMNVNSGPMGGDQQVGALISEGKIDLI
2bwnE           AALVFSSAYNANDATLSTLRLFPGLIIYSDSLNHASMIEGIKRNAGPKHNDVAHLRELIAADDPAAPKLI
3cq5A           TGVAANGSNEILQQLLQAFGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAIV
2btwB           NLIGFNSNEGEKLLLTSR----SREDFFPLSQFGVASIIVLNSLGINAPETAQYSPYRVFTQDNFFSNEK
2btwA           ----GFNSNEGEKLLLTS---RSREDFFPLSQFVTQVNQAYCGVASIIVLAQYSPYRVFTQDNFFSNEKT
3dzzB           DWCVFASGVVPAISAVRQFTSPGDQILVQEPVYNFYSVIEGNGRRVISSDLIYENSADLEEKLATPSVRV
1bjwA           ETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEERVRRAITPRTKAL
2bwpB           AALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRAHLRELIAADDPAAPKL
3bs8A           IVRMVSSGTEATMSALRLYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGLPDSVKLAFQQFGEDIAGV
1ajsA           -TGALRIGAEFLARWYNGTPTWENHNGVFTTAGFKDIRSYRYWDTEKRGLDLQGFLS-DLENAPEFSIFV
1djuB           ADMVLLGANQAFLMGLSAFLKDGEEVLIPTPFVSYAPAVILAGGKPVEVPTYRLNVDELKKYVTDKTRAL
3bh1C           ------------------------------MLLNALKHLAGID-----DAIHLLSPESIEPIQTLKTVHL
1cj0A           VNVQPYSGSPANFAVYTALEPHGRIMGLDLPDGGFMTDKKKISATSIFFETGYIDYDRLEENARLFHPKL
1ay4B           GLKSETTGALRQALELARMPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKA--DLAAAKKGDMVL
1c7nA           WIINTAGVVPAVFNAVREFKPGDGVIIITPVYYPFFMAIKNQERKIIECELLEIDFQKLEKLSKDKNNKA
1c8nA           --TPIALAYTVQSLPLIATQ-PAWLGTIADNYSKWRWVSLRIIYSPKCPTTTSGTLSYDRNDVAPGSRVQ
1dtyA           RFLTFRNGYHGDTFGAMSVCDDNSMHSLWKGYLPENLFAPAPQSRMDWDERDMVGFARLMAAHRHEIAAV
1d2fB           TVVYGPSVIYMVSELIRQWSETGEGVVIHTPYDAFYKAIEGNQRTVMPVALWFCDMGKLEAVLAKPECKI
1djuA           EIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYENVDELKKYVTDKTRAL
1agxA           HAFVSQWGALGTLVEGKPYWFRSSVKKHNNSEFNIEKIQGDALPGQIVYGSDNMMPDAYQAFAKAGVKAI
2eh6A           KVFFANSGTESVEAAIKLARKKWKFISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSV
3d46A           PLDCWMSQDVNYATKLAHACAPFNLKWIEELPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTLAID
1cj0B           VNVQPYSGSPANFAVYTALVPHGRIMGLDLPDHGFMTDKKKISATSIFFETGYIDYDRLEENARLFHPKL
1e9yA           -KLNYVEAVALISAHIMEERAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPTKLVTVHTPI
3ei9A           DDDVFVSDGAKISRLQVMFGSNVTIAVQDPSYPGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRI
2egyD           PELITTGSQQALDLVGKVFDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEGALEEVLKRERPRFLY
3ei9B           DDDVFVSDGAKISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGFFPDLSTVGRTDII
3ei7B           DDDVVSDGAKCDISRLQVMPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPEFFPDLSTVGRTDII
3bwnE           QLCQ----AAVHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWFDKK-------GPYIE
3eiaB           DVFVSDGAKCDISRLQVMFPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPEFFPDLSTVGRTDII
2bieB           ILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAAKANSYQSIPDFSEFQLNE
2egyB           EVLITTGSQQALDLVGKVFDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKRELY
3bh1D           ------------------------------------------------DAIHLLSPESIEPIQTLKTVHL
3ei6B           DDDVVSDGAKCDISRLQVMPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPEFFPDLSTVGRTDII
1bw9A           ------------------------------------------------------APCAMGGVITTEVATL
3ei7A           DVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYGQTGQFNTDVQKYGNIEYMRCTPEFFPDLSTVGRTDII
3cbfA           EVLITTGSQQALDLVGKVFDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEGALEEVLKRERPRFLY
1bs0A           RALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTARLLASPCPGQQMV
3e2fA           EILVAVGAYGSLFNSIQGLPFYDCYEPMVRMAGAVPVFIPLRSKPTDGSSDWTFDPRELESKFSSKTKAI
1c1dA           ------------------------------------------------------APCAMGGVITTEVATL


                         +         .         .         .         .         *         .:210
query           YIETPTNPLMLEFDIEXXXXXXXXXXXXXXXDNTFYSPIYQRPIEDGADIVLHSATKYLAGHNDVLAGVV
3e6gA           WIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIA
3e6gB           WIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIA
3e6gD           WIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIA
2ctzA           WVESIGNPALNIPDLEALAQAAREKGVALIVDNTFGMGGYLRPLAWGAALVTHSLTKWVGGHGAVIAGAI
2cb1A           FVETVANPALLVPDLEALATLAEEAGVALVVDNTFGAAGACRPLAWGAHVVVESLTWASGHGSVL-GGAV
3cogD           WIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
1cs1A           LVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTYLNGHSDVV-AGVV
1cl1B           FLESPGSITMEVHDVPAIVAAVRSVVPDAIIMNTWAAGVLFKALDFGIDVSIQAATYLVGHSDAMIGTAV
1cl1A           FLESPGSITMEVHDVPAIVAAVRSVVPDAIIMITWAAGVLFKALDFGIDVSIQAATYLVGHSDAMIGTAV
3d19B           AATNIWGFKRKILGLILTCKLPGQNNFPLLVDHTSREADYEGKLDALPDAIIKENVFFLADHAKFIGHLL
3cogB           WIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
1ddzA           AKYLDKCK-----DGDEELNRLIELNVLEQVHNVCATSIVQDAWDAGQELTVQGVVYGVGDGKLRDLGVV
3d19C           AATNIWGFKRKILGLILTCKLPGQNNFPLLVDHTSREADYEGKLDALPDAIIKENVFFLADHAKFIGHLL
3d19D           AATNIWGFKRKILGLILTCKLPGQNNFPLLVDHTSREADYEGKLDALPDAIIKENVFFLADHAKFIGHLL
3bn1D           KAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFTTNDDDLAAKMR
1e5eA           YFETPANPTLKIIDMRVCKDAHSQEGVLVIADNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLI
2c7tA           KAIIPVHLFGSMANMDEINEIAQEHNLFVIEDQSHGSVWNNQRAGTIGDIGAFSCQQGKVLTAGEGGIIV
2c81A           KAIIPVHLFGSMANMDEINEIAQEHNLFVIEDQSHGSVWNNQRAGTIGDIGAFSCQQGKVLTAGEGGIIV
3ecdA           -IIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIHANPVEHAHVVTSTTHKTLRGPRG--GFVL
3ecdD           -IIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGPVEHAHVVTSTTHKTLRGPRG---GFV
3dr7B           MPVHLYGQICDMDPILEVARRHNLLVIE---DAAEAVGATYRGKKSGSLGDCATFSFFTTNDDDLAAKMR
1e5eB           YFETPANPTLKIIDMRVCKDAHSQEGVLVIADNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLI
3bcxA           KAIMIAHTLGNLFDLAEVRRVADKYNLWLIEDDALGSTYDGKMAGTFGDIGTVSFYPAHHITMGEGGAVF
3dr4B           KAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGSLGDCATFSFFGNAIITDDLAAKMRLL
3ecdC           LIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIHANPVEHAHVVTSTTHKTLRGPRG---GFV
1ejiA           LIIAGTSCYSRNLDYARLRKIADDNGAYLADAGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGIFYRKG
3bn1C           MPVHLYGQICDMDPI---LEVARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFTTNDDDLAAKMR
3bcxB           MIAHTLGNLFDLAEVRRVADKYNLWLIEDC-CDALGSTYDGKMAGTFGDIGTVSFYPAHHITMGEGGAVF
3dr4D           KAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGSLGDCATFSFFGNAIITNDDDLAAKMR
1eg5B           VSIAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFKLEVDYASFSAHKFHGPKGVGITYIR
3dr4A           TKIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGSLGDCATFSFFGNAIITNDDDLAAKMR
3ecdB           -IIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAANPVEHAHVVTSTTHKTLRGP---RGGFV
3bb8A           KAIMIAHTLGNLFDLAEVRRVADKYNLWLIEDDALGSTYDGKMAGTFGDIGTVSFYPAKHITMGEG-GAV
3bwnA           LVTSPNNPDGTIRETVVDEAKVIHD------FAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRIGWAL
2dkjA           VIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVHPNPLPYAHVVTSTTHKTLRGPRGGLILSN
1ecxA           SIMAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFKLEVDYASFSAHKFHGPKGVGITYIR
1ecxB           SIMAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFKLEVDYASFSAHKFHGPKGVG--ITY
1b9hA           MPVHMAG-LMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVGELDSIATFSFQNGKLMTAGEGGAVV
1c7gA           CLAVTVNLPVSMANMRAVHEMASTYGIKIFYDATENAYFIKEQEAGYENVSIKDIVHEMFSYADGCGGFL
3e9kA           LFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVLYLHDWGVDFACWCSYKYLNAGAGGIAGAF
3bn1A           MPVHLYGQIC---DMDPILEVARRHNLLVIEDAAEAVGATYRGKKSGGDCATFSFFGNIITTGE--GGMI
3dr4C           MPVHLYGQIC---DMDPILEVARRHNLLVIEDAAEAVGATYRGKKSGGDCATFSFFGNAIITTGE-GGMI
1eg5A           VSIAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFSLEKDYASFSAHKFH-GPKGVGITYI
1bj4A           LIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMI
2cy8A           IAEPVGSHFVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGI
3bwnD           LVTSPNNPDGTIRETVVNAKVIHD-------FAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRI-GWA
3bcbA           HSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLLIQQGARVGRIDAFVQSLDNFMVPV---GGAII
2aeuA           TGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVRPPALKLGADLVVTSTDKLMEGPRG---GLL
1c4kA           AVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSSSPLLIDDLGPEDPGIIVVQSVHKQQAGFSQTSQIHK
2cfbA           ILEPVVGNPPDAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGA
1c0nA           AITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHVDVQALDCDFYVFSGHKLYGPTGIGILYVK
3bcaA           HSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLLIQQGARVGRIDAFVQSLDNFMVPV---GGAII
1ax4A           VSTVTCNSPVSMSNLKEVYEIAKQHGIFVVMDSCENAYFIKARDPKYKNATIKEVIFDMYKYADALTMLL
2dgmE           VPTFGVTYTGNYEFPQPLHDALDKFQADTGIDAASGGFLAWDFRLPRVKSISASGHKFGLAPLGCG-WVI
3b8xB           LTVNLLGNPNNFDEINKIIGGRDIILLE---DNCESMGATFNNKCAGTFGLMGTFSSFYSNHIATMGGCI
2a7vA           IIAGTSAYARL-IDYARMREVCDEVKAHLLADMAHISGLVIPSPFKHADIVTTTTHKTLRGARSGLIFYR
3b8xA           KAILTVNLLGNPNNFDEINKIIGGRDIILLEDNCESMGATFNNTFGLMGTFSSFYSNHIATM---EGGCI
2ch1A           FLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCGVPFYMDKWEIDAVYTGAQVLGAPPGITPISI
2dr1A           TITYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMGGAIKFDKWGLDVVFSSSQKAFGVPPGLAIGAF
2ch2A           FLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCGVPFYMDKWEIDAVYTGAQVLGAPPGITPISI
2aevA           TGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVRPPALKLGADLVVTSTDLMEGPR----GGLL
3dc1D           TVPNGNNPTGNSLTSEARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRIGFL
2dgkA           VPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDIVWDFRLPRVKSISASGHKFGLAPLGC-GWVI
3bc8A           HSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYMHLIQQGARVGRIDAFVQSLDNFMVPV---GGAII
2dgmB           VPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDIVWDFRLPRVKSISASGHKFGLAPLGCG-WVI
3d19E           AATNIWGFKRKILGLILTCKLPGQNNFPLLVDHTSREADYEGKLDALPDAIIKENVFFLRDHAKFIGHLL
2bwnD           AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGRDGLMHRIDIFNGTLAAYGVFGGYIA
1b9iA           IMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVGELDSIATFSFQNGKLMTAGEGGAVV
1b8gB           LVTNPSNPLGTTMTRNELYLLLSFVEDKGIHDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVV
3d19A           AATNIWGFKRKILGLILTCKLPGQNNFPLLVDHTSLIQLNEGKLDALPDAIIKENVFFLRIMADHAKFIG
2dgmA           VPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDIVWDFRLPRVKSISASGHKFGLAPLGCG-WVI
3e77C           YYCANETVHGVEFDFIPDVKGAVLVC-----DMSSNFLSKP-VDVSKFGVIFAGAQKNVGSAGVTVVIVR
2bwnB           AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVYGPRGAGVAERDGLMHRIDIFNGTLAAYGVFGGYIA
3dc1B           TVPNGNNPTGNSLTSERKKEIYELARKYDFLFLQFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRIGFL
3b46A           IINTPHNPVFTREELTTLGNICVKHNVVIISDEVYEHLYFTLSPEIGQLTLTVGSAGSFAATGWRIGWVL
2bwnA           AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVYGPRGAGVAERDGLMHRIDIFNGTLAAYGVFGGYIA
3bwnB           LVTSPNNPDG--TIRETVVNRPDDDEAKVIHDFAYYWPHYPITRRQDHDIMLFTFSKITGHAGSRIGWAL
3bwoC           LVTSPNNPDGTIRETVVAKVIHDFA--------YYWPHYTPITRRQDHDIMLFTFSIT--GHAGSRIGWA
2bwoD           AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYRDGLMHRIDIFNGTLAKAYGVFGGYIAASA
3bwnF           LVTSPNNPDGTIRETVVAKVIHD--------FAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRIGWAL
2dgkC           VPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDIVWDFRLPRVKSISASGHKFGLAPLGCG-WVI
2bwoB           AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAA-S
2bwpA           AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYRDGLMHRIDIFNGTLAKAYGVFGGYIAASA
1dfoB           MIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNAHVVTTTTHKTLAG----PRGGL
3dydA           IVNNPSNPCGSVFSKRHLQKILAVAARQCVPDEIYGDEPLATLSTDVPILSCGGLAKRWLVPGWRLGWIL
2dr1B           TITYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMGGAIKFDKWGLDVVFSSSQKAFGVPPGLAIGAF
2dgmC           VPTFGVTYTGNYEFPQPLHDALDKFQADTGIDAASGGFLAWDFRLPRVKSISASGHKFGLAPLGCGWVIW
3b46B           IINTPHNPVFTREELTTLGNICVKHNVVIISDEVYEHLYFTLSPEIGQLTLTVGSAGSFAATGWRI-GWV
1djpA           IHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMV
2c44B           VATITSNSAVSLANLKAMYSIAKKYDIPVVMDSAENAYFIKQREAEYKDWTIEQITRETYKYADMLAGLL
3e77A           YYCANETV-----HGVEFDFIPDVKGAVLVCDMSSNFLSKPVD-VSKFGVIFAGAQKNVGSAGVTVVIVR
3caiA           AVNSASGTLGGVTDLRAMTKLVHDVGALVVVDHSAAAPYRLDIRETDADVVTVNAHAWGGPPIGAMVFRD
1b8gA           LVTNPSNPLGTTMTRNELYLLLSFVEDKGIHDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVV
2bwoA           AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPAERDGLMHRIDIFNGTLAAYGVFGGYIA
2e7jA           LITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNAYAIGRMPVSLKEIGADFIVGSGHKSMAASGPIGVMGM
2e54A           FLEPIQGEPATKEFLEEARKLCDEYDALLVFDEVQRTGKLFAYQKYGVVPDVLTTAKGLGGGVP--IGAV
2bkwA           TVTHVDTSTAVLSDLKAISQAIKQTSPETFFVVDAVCSIGCEEFEWGVDFALTASQAIGAPAGLSISLC-
3bwoA           LVTSPNNPDGTIRETVVAKVIHD--------FAYYWPHYTPITRRQDHDIMLFTFSITGHAGSRI--GWA
2c44C           VATITSNSAGGLANLKAMYSIAKKYDIPVVMDSAENAYFIKQREAEYKDWTIEQITRETYKYADMLAGLL
3e77B           YYCANETV-----HGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSK-FGVIFAGAQKNVGSAGV---TVV
1eghA           FFWDPLNAVPHDPDVKALLRLATVWNIPVATNVATADFIIQSPHFNDADILIPDYQRYLADR--------
2c44A           VATITSNSPVSLANLKAMYSIAKKYDIPVVMDSAENAYFIKQREAEYKDWTIEQITRETYKYADMLAGLL
1b93B           FFWDPLNAVPHDPDVKALLRLATVWNIPVATNVATADFIIQSPHFNDADILIPDYQRYLADR--------
2bwnE           AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPAERDGLMHRIDIFNGTLAAYGVFGGYIA
3cq5A           FVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSLEKYPTKLVVSRTMSKAF-DFAGGRLGYF
2btwB           TKAIAPEVVAKQGTLDELGRLIASYGVKVKVNDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGH
2btwA           KAVIAPEVVARQGTLDELGRLIASYGVKVKVNHTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQRGGHI
3dzzB           FCNPPIGYAWSEEEVKRIAELCAKHQVLLISDEIHITPAFTVDWDAKNWVVSLISPSTFNLAALHAACAI
1bjwA           VVNSPNNPTYPKEVLEALARLAVEHDFYLVSDELYEGEHFSPGRVAPEHTLTVNGAAAFAMTG--WRIGY
2bwpB           AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYRDGLMHRIDIFNGTLAKAYGVFGGYIAA--
3bs8A           IVEPMGVVPPQEGFLQGLRDITEQYGSLLIFDTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPV--GAY
1ajsA           LHACAHNPTGTDPQWKQIASVMKRRFLFPFFDSAYQGFASYFVSEGFELFCAQSFSKNFGLYNERVGNLT
1djuB           IINSPCNPTGAKKDLEEIADFVVEHDLIVISDEVYHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVA
3bh1C           GSSNPRLHTDEVLIALSVSAATDSNAQKALDQLKNLRGCDVH------TTTILGSVDEGIFRN---LGVL
1cj0A           IIAGTSCYSRNL-DYGRLRKIADENGAYLMADGLVVAGVVPSPF-EHCHVVTTTTHKTLRGCRRGVRSVD
1ay4B           LHGCCHNPNLTLDQWAEIASILEKTGALPLIDLADAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLL
1c7nA           LLFCPHNPVGRVWKKDELQKIKDIVLKSDLMGYEHTVFQSIDEQLADKTITFTAPSKTFNIAGMGMSNII
1c8nA           LSQTYKAIPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDKAFAALTAFDQNQFCPCTVHIGSDGGPAVAV
1dtyA           IIEPIVQGMYHPEWLKRIRKICDREGILLIADEIARTGKLFACEHAEIAPDILCLGKALTGGTMTLSATL
1d2fB           MLLNPTGKVWTCDELEIMADLCERHGVRVISDEGEQPHIPWSNVARGDWALLTSGSKSFNIPALTGAYGI
1djuA           IINSPCNPTGAVLTKKDLEEIADFVVEHDLIDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVA
1agxA           IHAGTGNGSMANYLVPEVRKLHDEQGLQIVRSSRVAQGFVLRNAEQPDDKYGWIAAHDLNPQKARLMALA
2eh6A           YKLLDEETEASEDFLSKLQEICKEKDVLLIIDEVQRTGEFYAYQHFNLKPDVIALAKGLGGG---VPIGA
3d46A           IMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYSH-----HAVITFTNTPFSEFLMTSPDCSTLRP
1cj0B           IIAGTSCYSRNLD-YGRLRKIADENGAYLMADGLVVAGVVPSPF-EHCHVVTTTTHKTLRGC---RAGMI
1e9yA           EANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFDIAAGTAVRFEPGEEKSVELI-
3ei9A           FFCSPNNPTGAAATREQLTQLVEFAKKNGSIDSAYAMSIFEIPGAEEVAMETASFSNYAGFTGVRLGWTV
2egyD           LIPSFQNPTGGLTPRKRLLQMVMERGLVVVEDDAYRELYFGEAAREAGYPGVIYLGSFSKVLSPGLRVAF
3ei9B           FFCSPNNPAATREQLTQLVEFAKKNGSIIVYDSAYPRSIFEIPGAEEVAMETASFSNYAGFTGVRLGWTV
3ei7B           FFCSPNNPTGAAAQLTQLVEFAKKNGSIIVYDSAYAMSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTV
3bwnE           LVTSPNNPDGTIRETVVEAKVIHD-------FAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRI-GWA
3eiaB           FFCSPNNPAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSEIPGAEEVAMETASFSQYAGFTGVRLGWTV
2bieB           NDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKAGAQKNLGPSGVTVVIVKKDLLVEQVP
2egyB           LIPSFQNPTGGLTPLPARKRLLQMVMERGLVEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAV
3bh1D           GSSNPRLHTDEVLIALSVSAATDSNAQKALDQLKNLRGCDTTTILGSVDEGIFRNL-----------GVL
3ei6B           FFCSPNNPTGAAAQLTQLVEFAKKNGSIIVYDSAYAMSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTV
1bw9A           DCSVVAGAANNVIADEAASDILHARGILYAPDFVANAGGAILVGREVLGWSESVVHERAVAIGDTLNQVF
3ei7A           FFCSPNNPAATREQLTQLVEFAKKNGSIIVYDSAYAMSIFEIPGAEEVAMETASFSKYAGFIPKKLLYSD
3cbfA           LIPSFQNPTGGLTPRKRLLQMVMERGLVVVEDDAYRELYFGEAAREAGYPGVIYLGSFSKVLSPGLRVAF
1bs0A           VTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVFGKGFGVSGAA
3e2fA           ILNTPHNPLGKVYTRQELQVIADLCVKHDTLTGHTHVKIATLPGMWERTITIGSAGTFSVTGWKLGWSIG
1c1dA           DCSVVAGAANNVIADEAASDILHARGILYAPDFVANAGAIHLVGREVLGWSESVVHERAVAIGDTLNQVF


                         .         .         .         +         .         .         .:280
query           VTNSLELYEKLFYNLNTTGAVLSPFDSYQLLRGLKTLSLRMERSTANAQEVVAFLKDSPAVKEVLYTGRG
3e6gA           VVGDNELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLG
3e6gB           VGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLG
3e6gD           VGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYSGFG
2ctzA           VGELAFIVKARVDGLRDQGQALGPFEAWVVLLGMETLSLRAERHVENTLHLAHWLLEQPQVAWVNYGKPG
2cb1A           LSRETELWRNYPQFLQPWGMALSPFNAYLLFQGLETVALRVARMSETARFLAERLQGHPKVKALRYASGG
3cogD           SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYTGCT
1cs1A           IAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLPENQGHEIAAQKGFG
1cl1B           CNA--RCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHSGLF
1cl1A           CNARC--WEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALS
3d19B           DPSERKLVDTA-------RNFSNDFDEL-MYQAIDLESMKPQS--QTAPLLDQFLDQNRVSVASLRTARD
3cogB           SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLP
1ddzA           VNSSDDISKFYRTKSDSGALKAGNPNAPLVQVTKGGESELDSTMEKLTPQFFSNLAHTQTPEILWIGPAG
3d19C           DPSERKLVDTARN-------FSNDFDEL-MYQAIDLESMKPQS--QTAPLLDQFLDQNRVSVASLRTARD
3d19D           DPSERKLVDTA-------RNFSNDFDEL-MYQAIDLESMKPQS--QTAPLLDQFLDQNRVSVASLRTARD
3bn1D           LLRGQGMDPNRWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALT
1e5eA           CGKALLQQIRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGYG
2c7tA           TKNP-RLFELIQQLRADSNYCLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSKIDGIKVMKRVKFG
2c81A           TKNHGDMQLVKKGDIQGSNYCLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPQV
3ecdA           TNDEEIAKKINSAVFGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNH
3ecdD           LTNDEEIAKKINSAVGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNH
3dr7B           LLRGQGMDPNRRYPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALT
1e5eB           CGKALLQQIRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYFEDHEGHDIAKKQMRM
3bcxA           TQSAELKDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATEN
3dr4B           RGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALT
3ecdC           LTNDEEIAKKINSAVGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNH
1ejiA           VRSVDPKTGKETLESLINSAVFPGLQGGPHNHAIAGVAVALLQVLANCRALSDALTELGYKIVTGGSDNI
3bn1C           LLRGQGMDPNRRYWFPIVGYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALT
3bcxB           TQSAEGYDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATEN
3dr4D           LLRGQGMDPNRWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALT
1eg5B           KGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAEIAVEELSEAAKHEKLRSKLVSGLNLGAHIITPLEI
3dr4A           LLRGQGMDPNRRYWFPIVGYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALT
3ecdB           LTNDEEIAKKINSAVFPGPLMHVIAGKAVAFGEALTDDFKTDRVLANAQALGDVLKAGGVDLVTGGTDNH
3bb8A           FTQSAELKSIIESFRDWGRLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATEN
3bwnA           VKDK-EVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVES
2dkjA           DPELGKRIDKLIFPGIQGGPVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNH
1ecxA           KGV--PIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAAKHMEKLRSKLVSGLMNLGAHIITPLEISL
1ecxB           IRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEHMEKLRSKLVSGLMNLGAHIITPLEISL
1b9hA           FPDG-ETEKYETAFLRHSCGRPRDFSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPFRIPGLT
1c7gA           CMNDEEMFSAAKELVVVYEGMPSYGGLAGRGLREAMQYEYIEHRVKQVRYLGDKLREAGVPIVEPTGGHA
3e9kA           IHEKH-AHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALH
3bn1A           TTNDDDLAAKMRLLRGQFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALT
3dr4C           TTNDDDLAAKMRLLRGQFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALT
1eg5A           RKG--VPIRPLIHGGGQERGLRSGTQNVPGIVGAARAEIAVEKHEKLRSKLVSGLNLGAHIITPLEISLP
1bj4A           FYRKGVKLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGG
2cy8A           LGGREDVMGVLSGNPITAAAAIAAIDT-----------ILEDDVCAKINDLGQFAREAMNHLFARKGLNW
3bwnD           LVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVK
3bcbA           AGFNEPFIQDKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTP
2aeuA           AGKK-ELVDKIYIEGTKFGLEAQPPLLAGIYRALKNFNLERNFDLSKIEKLNKELKAIDDNINIVYERTP
1c4kA           KDSHIKGQLRYCDHKHFNNPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKAGSMFRPFVPPVV
2cfbA           YGGRAEIMKMVAPAGPTLSGNPLAMTTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHEVCG--GHIS
1c0nA           E------ALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALALSQLE
3bcaA           AGFNEPFIQDIMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLPIS
1ax4A           NIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYLHYRIGQVKYLGHAVF
2dgmE           WRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEDE
3b8xB           VTDDEEIYHILLCIRAHGWTRNLPMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKDHPYLDVQQETGES
2a7vA           KGVKAVDPKTGREIPYTFEDRINFAVFPSLQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNH
3b8xA           VTDDEEIYHILLCIRAHGWTRNLPKKNKVTGVKSDDQFEESFKFVLPGEYFLDKFKDHPYLDVQQETGES
2ch1A           SPKALDVIRNRRLLGNYWGCYDEPKRYHHTVASNLIFALREKRRIECAQILYEGLGKMGLDIFVKDPRHR
2dr1A           SERFLEIAEKMPERGWYFDIPLYVKYLKEKESTPSTPPMPQEMYEKRAKMVREGVREIGLDILAEPGHES
2ch2A           SPKALDVIRNRRLLGNYWGCYDEPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYHRLP
2aevA           AGKK-ELVDKIYIEGTKFGLEAQPPLLAGIYRALKNFNLAFERAKNFDLSKIEKLNKEKAIDDNINIVYE
3dc1D           TG-PKPLIERVILHIQVSTLHPSTFNQLMISQLLHE--WGEEGFMAHVDRVIDFYSNQKDAILAAADKWL
2dgkA           WRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEDE
3bc8A           AGFNEPFIQDIMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLHNP
2dgmB           WRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLAPDEG
3d19E           DPSERKLVDTARN--------FSNDFDELMYQAIDLESMKP--QSQTAPLLDQFLDQNRVSVASLRSIIH
2bwnD           ASARMAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGS
1b9iA           FPDG-ETEKYETAFLRHSCGRPRDFSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRT
1b8gB           YSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTKRLKQRQKKLVSGLQKSGISCLN--GNAG
3d19A           -----HLLDPSERKLVDTARNFSNDFDELMYQAIDLESMKPQ--SQTAPLLDQFLDQNRVSVASLRSIIH
2dgmA           WRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEDE
3e77C           DDLLGFALRECPSVLEYKVQAGNSSLYNEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVC--PVEP
2bwnB           ASARMVVRSYAPGFIFSTSAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKA---LGMPIIDHGS
3dc1B           TG-PKPLIERVILHIQVSTLHPSTFNQLMISQLLHEW--GEEGFMAHVDRVIDFYSNQKDAILAAADKWL
3b46A           SLNA-ELLSYAAKAHTRICFASPSPLQEACANSINDFEKMRQEYINKFKIFTSIFDELGLPYTA---PEG
2bwnA           ASA--RMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGDHGS
3bwnB           -VKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVES
3bwoC           LVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVES
2bwoD           RMVDAVRSYAPGFIFSTSLAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMP---IIDHGS
3bwnF           VKDK-EVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVES
2dgkC           WRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEDE
2bwoB           ARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGS
2bwpA           RMVD-AVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGS
1dfoB           ILAKGGSEELYGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNH
3dydA           IHD--RRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSITLSFLKSNADLCYGALAAIPGLRPV--RPSG
2dr1B           SERFLEIAEKMPERGWYFDIPLYVKYLKEKESTPSTPPMPQVFGINVALRIIEKMGGKEKWLEMYEKRAK
2dgmC           RDEEA-LPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEDE
3b46B           LSLNAELLSYAAKAHTRICFASPSPLQEACANSINDFEKMRQEYINKFKIFTSIFDELGLP--YTAPEGT
1djpA           AMTKTQDSKEL-----------------------------------------------------------
2c44B           CMKDDSFFDVYTECRTLCVVQGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAG
3e77A           DDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVKLSSIKSQTIYEIIDNSQGFYVC--PVEP
3caiA           PSVMNSFGSVSTNPYATGFGLLAGVVASIEYLAALDESARGSRRERLAVSMQSADAYLNRVFDYLMVSLR
1b8gA           YSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAEISCLNGNAG
2bwoA           ASARMVDAVRSYAPGFIFSAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMP--IIDHGSH
2e7jA           KEEWAELRRSEKYKNKEVELLGCTARGATIITLMASFPHVREEEVEKARRFAAEMEKLGIKQLGDNPHNH
2e54A           IVNERANVLEPGDHGTTFGGNPLACRVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADV--RGMG
2bkwA           ---SSRFDYALNDSKNGHVHGYFSSLRRWTPIENYEAGKGAYFATPPVQLINSLDV---ALKEILEEGLH
3bwoA           LVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVD
2c44C           CMKD-DSFFDVYTECRTLCVVQEGFPTYMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAG
3e77B           IVRDDLLGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQK
1eghA           ----------------------------------------------------------------------
2c44A           CMKDDSFFDVYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYRIAQVQYLVDGLEEIGVVCQQAGGHAA
1b93B           ----------------------------------------------------------------------
2bwnE           ASARDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGS
3cq5A           VANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLE---ELGYAVVPSES
2btwB           ISPLAAYNEQTDRFLIDVSRYKYPPVWVKTTDLWKANTVDSVSQKTRGF---------------------
2btwA           SPLAAYNEQTDRF-LIDVSRYKYPPVWVKTTDLWKANTVDSVSQKTRGF---------------------
3dzzB           IPNPDRAEESFFLAGIGEPNLLAPAAIAAYEEGHDWLRELKQVLRDNFAYAREFLAKEVPEVKVLDSNAS
1bjwA           ACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRLEGLTALGLKAVRPSG
2bwpB           ----------------------------------------------------------------------
3bs8A           GGKAEIMEQIAPSGPIYQALAMTAGLETLKQLTPDSYKNFIKKGDRLEEGISKAAEAHGIPHTFNRAGSM
1ajsA           VVAKERVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSRSELRARLEALKTP
1djuB           APSWIIERMVKFQMYNATFIQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVK--PKGA
3bh1C           VTSDPKFQK-------------------------------------------------------------
1cj0A           ILYNLESLINSAVFPGLQGHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNH
1ay4B           ALCADLAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPEL-RADWMAELEAVRSGMLREQLAGELRDLSGS
1c7nA           IKNPDIRESRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKAPL-IEG
1c8nA           PPG--DIFFKY-----------------------------------------------------------
1dtyA           TTR--EVAETISDGEAGCFMHGPTFMGNPLACAAANASLWQQQVADIEVQLREQLAPARDAEMVADVVLG
1d2fB           IENSSSRDAYLSALKGRDGLSSPSVLALTYQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIPQST
1djuA           APSWIIERMVKFQMYNATCPQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVK--PKGA
1agxA           LTKTNEIQNMF-----------------------------------------------------------
2eh6A           ILAREEVAQSFTPGSHGSTFGGNPL----ACRAGTVVVDEVEKLLPHVREVGNYFKEK--LKELKVKGRG
3d46A           QFDPI-----------------------------------------------------------------
1cj0B           FYRRGVRSVDQGGPHNHAIAGVAVALKQAMTPEFKE---YQRQVVANCRALSAALVELLILVDLRSKGTD
1e9yA           ----------------------------------------------------------------------
3ei9A           IPK--KLLYSDTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGY---DVYGGKN
2egyD           AVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSRLERREKAQAMLHALDREVPKEVRYTRPKGG
3ei9B           IPK--KLLYSDTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGY---DVYGGKN
3ei7B           IPK--KLLYSDGFPVAKDFNRIICTCFNLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYD---VYGGKN
3bwnE           LVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVES
3eiaB           IPK--KLLYSDGFPVAKDFNRIICTCFNLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYD---VYGGKN
2bieB           TMLQYHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGS
2egyB           AHP--EALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSRLERREKAQAMLHALDREVPKEVRYTRPKGG
3bh1D           VTS-------------------------------------------------------------------
3ei6B           IPKKL-LYSDGFPVAKDFNRIICTCFNCLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGY---DVYGGKN
1bw9A           E---------------------------------------------------------------------
3ei7A           GFPVAKDFNRIICTCFNGASNISQAGALACLTGLEAMHKVIGFYKENTNIIIDTFTSLGY---DVYGGKN
3cbfA           AVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSRLERREKAQAMLHALDREVPKEVRYTRPKGG
1bs0A           VLCSSTVADYLLQFARHLSTSMPPAQAQALRASLAVGDARREKLAALITRFRAGVQD---LPFTLADSCS
3e2fA           PAHLIKHLQTVQQNSFYTC---ATPLQAALAEAFWIDIKRMKELEVKRDRMVRLLNSVGLKPIVPDGGYF
1c1dA           EISDNDG---------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GMISFKVADETRIPHILNSLKVFSFAESLGGVESLITYPTTQTHADIPAEVRHSYGLTDDLLRLSIGIED
3e6gA           GIVSIVLGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIED
3e6gB           GIVSIVLKGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHEQL--------GISDALVRLSVGIED
3e6gD           GIVSIVLKGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTR--------EQLGISDALVRLSVGIED
2ctzA           AVLTFLKGGYEAAKRFISRLKLISHLANVGDTRTLAIHPASTTHSQLSPEEQAQAGVSPEMVRLSVGLEH
2cb1A           PILTLDLGDLERASRFLGAIRLL-KAANLGDARTLLVHPWTTTHSRLKEEARLQAGVTPGLVRVSVGLED
3cogD           GMVTFYIKGTLQHAEFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLED
1cs1A           AMLSFELDGEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGIED
1cl1B           SFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGE--IDFSGTLIRLHIGLED
1cl1A           KGHEFWKRDFTGSSGYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGE--IDFSGTLIRLHIGLED
3d19B           LIEQCKIKVFREADRFLEIIDMYDVHLT------------------------------------------
3cogB           SHPQHELVK--RQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLELPSDTLIRLSVGLED
1ddzA           EVFVHRNIANQCIHSDMSFLSVLQYAVQYLKVKRVVVCGHYACGGCAAALGDSRLGLIDNWLR---HIRD
3d19C           LIEQCKIKVFREADRFLEIIDMYDVHLT------------------------------------------
3d19D           LIEQCKIKVFREADRFLEIIDMYDVHLT------------------------------------------
3bn1D           GTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYHLATDDLKIAEACGVDGLNLPTHAGLTEAD
1e5eA           SMITFILKSGFGAKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIED
2c7tA           GLNADQFCEILRFYLHPPYLPVHKNPLFCPWTKNRYLKSVRKTEAYWRGLYPVSERASGQSIVIHHAPSH
2c81A           SRQTYVFRFDPVKFGGLNADQFCEILREKLNMGTFYLHPPYLPVHKNPLFCPWTKNRYLKSVRKTEAYWR
3ecdA           LLLVDLRALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFEVGRLILEVFEALRTNPEG
3ecdD           LLLVDLRPKGLKGAQVEQALEPFDPEKPTITSGIRLGTPAGTTRGFGAAEFEVGRLILEVFEALRTNPEG
3dr7B           GRVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYHLATDDLKIAEACGVDGLNLPTHAGLTEAD
1e5eB           YITFILKSGFEGAKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIED
3bcxA           SDITLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKELTNTDRIMNQTFWIGIYPGLTHDH
3dr4B           GTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYHLATDDLKIAEACGVDGLNLPTHAGLTEAD
3ecdC           LLLVDLRPKERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFEVGRLILEVFEALRTNPEG
1ejiA           LDLRSKGTDGGRAEKVLNKNTCPGDKSALRPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELQIQSHA
3bn1C           GTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYHLATDDLKIAEACGVDGLNLPTHAGLTEAD
3bcxB           SDITLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKELTNTDRIMNQTFWIGIYPGLTHDH
3dr4D           GRVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYHLATDDLKIAEACGVDGLNLPTHAGLTEAD
1eg5B           SLPNTLSV----SFPNIRGSTLQNLLSGYGIYVSTRHVLDAGVDR----------RIAQGAIRISLCKYN
3dr4A           GTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYAHATDDLKIAEACGVDGLNLPTHAGLTEAD
3ecdB           LLLVDLRPKGLKGAQVEQALEPFDPEKPTITSGIRLGTPAGTTRGFGAAEFEVGRLILEVFEALRTNPEG
3bb8A           SDPSWFGFSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELNTDRIMNQTFWIGIYHDH
3bwnA           DAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLV-SELRRHKVMSRAGERCGSDKKHVRVSMLSRE
2dkjA           LFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIRGFTPEEMPLVAELIDRALLEGP
1ecxA           PNTLSVSFPNIRGSTLQNLLSGYGIYVSTHVLDAMGVDR----------------RIAQGAIRISLCKYN
1ecxB           PNTLSVSFPNIRGSTLQNLLSGYGIYVSTRHVLDAMG---------------VDRRIAQGAIRISLCKYN
1b9hA           EERRNALVDRLVEAGLAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNDAISSDCVWLHHRVLLAGEPE
1c7gA           VFLDARRFCPHLTQDQFPAYMETGVRSMERGIVSAGRSKETGENHRPKLET-----VRLTIPRRVYTYAH
3e9kA           NYGVVNIITPSHVEE-------RGCQLTITFSVPNKDVFQELEKRGVVCDKRNPNGIRVAPVPLYNSFHD
3bn1A           GTVRLGEGLSTTRDQVIKDLDALGIESRPVFHMHIMPPYAHLATDDLKIAEACGVDGLNLPTHAGLTEAD
3dr4C           GMYTVRLGEGLSTTRD----QVIKDLDALGIESRPVFHPMHIMPPDLKIAEACGVDGLNLPTHAGLTEAD
1eg5A           NTLSV-------SFPNIRGSTLQNLLSGYGIYVSTHVLDAGVDRRIAQGAIRISLCKYNTE-------EE
1bj4A           SDNHLILVDLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQS
2cy8A           LAYGRFSGFHLMPGLPPGSITRAEVARPDVKMIAAMRMALILEGVDIGGRGSVFLSAQHEREHVEHLVTT
3bwnD           ESDAFTLPYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSELRRHKVMSRAGERCGSDKKHVRVSMLSDV
3bcbA           HLKTIDGHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSH-ADNYPCAYLNAAAAIGMQD
2aeuA           TGFVIKRVYKDDTINIKKLIEIGFNLLKNYG----IITITVAGMPGASKSLRIDLT------SRDAERID
1c4kA           NGKKWEDGDTEDMANNIYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDHGIIPESILFLMTPAE
2cfbA           GMFGL---FFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIYLAPSQFEAGFTSLAHTE---------AD
1c0nA           SVPDLTLYGPQA--RLGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLAMYN
3bcaA           LAMTLKTIDGHHDKALFTRQVSGARAVPLGNVQTVSGHTFRGFM-----SHADNYPCAYLNAAAAIGMQD
1ax4A           VDCKKLVPQIPG-DQFPAQAVINALYLESGVRAVEIGSFLLGRDPATGEQKHADEFMRLTIARRVYTNDH
2dgmE           GIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRIM-------CRRGFEMDF
3b8xB           SSFIIKKDSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDVLKYFDYTVHNNNAEYLDKNGLFVGNHQIE
2a7vA           LVLVDLRPKGLLVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKS
3b8xA           SSFIIKKDSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDVLKYFDYTVHVDNAEYLDKNGLFVGNHQIE
2ch1A           LPTVTKGVDWWKVSQYAMNNFSLEVQGGLGPTFGKAWRVGIMGECSTVQKIQFYLGFKESLKATHPDYI-
2dr1A           PTITAVLTPPGIKGDVYEAMRKRGFELAKGYGSVK------------EKTFRIG-------HMGYMKFED
2ch2A           TVTGIMIVDWWKVSQYAMNNFSLEVQGGLGPTFGKAWRVGIMGECSTVQKIQFYLGFKESLKATHPDYI-
2aevA           RTPTGFVIKRVYKDDTINIKKLIEIGFNLLKNYGIITIT-VAGMPGASKSLRIDLT------SRDAERID
3dc1D           TGLAEWHAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAP--------SPYLRASFSSEQ
2dgkA           GIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRIM-------CRRGFEMDF
3bc8A           ISLAMTLKTTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADN-----YPCAYLNAAAAIGMQD
2dgmB           IPAVCFKLKD-GEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRIM-------CRRGFEMDF
3d19E           PLLADHVFREAD--RFLEIIDMYDVH--------------------------------------------
2bwnD           HIVPVVIGPVHTKAVSDMLLSDYGVYVQPINFPTVPRGT--------------------ERLRFTPSPVH
1b9iA           EERRNALVDRLVEAGLPFAAFRAIYRTDAFWELGAPDESVDAIARRCPNTDAISSDCVWLHHRVLLAGPE
1b8gB           LFCWVDMRHLLRSNTFEAE---MELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPE--------RT
3d19A           PLLADHVFREAD--RFLEIIDMYDVH--------------------------------------------
2dgmA           GIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRIM-------CRRGFEMDF
3e77C           QNRSK----------------MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNED
2bwnB           HIVPVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRGTER--------------------LRFTPSPVH
3dc1B           TGLAEWHVPAAGWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAP--------SPYLRASFSSEQ
3b46A           TYFVLDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKEHEKAAENLLRFAVCKAY
2bwnA           HIVPVVIGPVHTKAVSDMLLSDYGVYVQPINFPTVPRGT--------------------ERLRFTPSPVH
3bwnB           DAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLV-SELRRHKVMSRAGERCGSDKKHVRVSMLSRE
3bwoC           DAFTLPKYPEAFCNYFGKSLE-SYPAFAWLGTKEETDLVSELRRHKVMSRAGERCGSDKKHVRVSMLSRE
2bwoD           HIVPVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRGTER--------------------LRFTPSPVH
3bwnF           DAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLV-SELRRHKVMSRAGERCGSDKKHVRVSMLSRE
2dgkC           GIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRIM-------CRRGFEMDF
2bwoB           HIPVVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------LRFTPSPVHD-------LKQ
2bwpA           HIVPVVIGDPVHTKAVSDMLSDYGVYVQPINFPTVPRGTER--------------------LRFTPSPKQ
1dfoB           LFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDVGTPAITRRGFKEAEAKELAGWMCDVLD----SIN
3dydA           AMYLMVGIEMEHFPEFENDVEFTERLVAEQSV-----HCLPATCFEYPNFIRVVITVPEVMMLE--ACSR
2dr1B           MVREGVREIGLDILAEPGHESPTITAVLTPPGIKGDEVYEAMRKRGFELAKGYGSVKEKTFHMGYMKFED
2dgmC           GIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRIM-------CRRGFEMDF
3b46B           YFVLVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKEHEKAAENLLRFAVCKAY
1djpA           ----------------------------------------------------------------------
2c44B           GLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTGKQLPCPAEL-----LRLTIPRATYTQTH
3e77A           QNRSKMNIPF--RIGNAKGDDALEKRFLDKALELNMLSLKG--------------HRSVGGIRASLYNED
3caiA           SLPLVMLIGRPEAQIPVVSFA-VHKVPADRVVQRLANGILAIANTGSR--VLDVLGVNDGAVTVGLAHYS
1b8gA           LFCWVDMRHLLRSNTFEAE---MELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPE--------RT
2bwoA           IVPVVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRGT--------------------ERLRFTPSPKQ
2e7jA           DLMFFHAEVLYEISKKAKGGRFFLHGIKPGLTRYFKLSTYGLSDEEVDYVLN---AFKEIIEKYS-----
2e54A           LMIGIQFREEVSNREVATKCFENKLLVVPAGNNTIFLPPLTVEYGEIDLAVE------------------
2bkwA           KRWDLHRESDWFKDSLVNGLQLTSVPSNSAHGLTAVYVADPPDSHGVVIAGGIHKDIGPKYIRIGHGVLP
3bwoA           AFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSELRRHK--VMSRAGERCGSDKKHVRVSMLSRE
2c44C           GHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTGKQLPCPAELLRLTIPQTH
3e77B           MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKG---------------------HRSVGGIRASLYNED
1eghA           ----------------------------------------------------------------------
2c44A           FVDAGKLL----PHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTGKQLPCPAELLRLTIPQTH
1b93B           ----------------------------------------------------------------------
2bwnE           HIVPVVIGPVHTKAVSDMLLSDYGVYVQPINFPTV--------------------PRGTERLRFTPSPKQ
3cq5A           NFVFF--------GDFSDQHAAWQAFLDRGVLIRDVGIAGH---------LRTTIGVPEENDAFLDAAAE
2btwB           ----------------------------------------------------------------------
2btwA           ----------------------------------------------------------------------
3dzzB           YLAWVDISALGNAEDFCKYLREK---------TGLIISAGNGYRGNGHEFVRINLACPK---------EL
1bjwA           AFTSPIAPDEVRAAERLLEAGVAVVPGTDFAAFGHVRLSYATSEENL-----------------------
2bwpB           ----------------------------------------------------------------------
3bs8A           IGFFFTNEPVINYETAKASDLKLFASYYKGMANEGVFLPPSQFEG-----LFLSTAHTDEDIE--NTIQA
1ajsA           GTWNHITDQIGFSFTGLNPKQVEYLINQKH----IYLLPSGRINMCGL-----------TTKNLDYVATS
1djuB           FYIFPRIRDTGL--------TSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYE--KLEEAMER
3bh1C           ----------------------------------------------------------------------
1cj0A           VDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALGTPALTSRGLLEKDFQKVAHFIHRGIELTVQIQD
1ay4B           DRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYSRINIAGL-NDNTI-----------------------
1c7nA           TYLQWIDF----RALKMDHKAMEEFMIHKAQI---FFDEGYIFGDGGIGFERINLAAPSSVIQ--ESLER
1c8nA           ----------------------------------------------------------------------
1dtyA           AIGVVETTHPVNMAALQKFFVEQGVWIRPFGKLIYLMPPYIILPQQLQRLTA------------------
1d2fB           YLAWLDLRPLNIDDN--------ALQKALIEQEKVAIMPGYTYGEEGRGFVRLNAGCPR---------SK
1djuA           FYIFPRIRDTGLTSK--------KFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAY---------EK
1agxA           ----------------------------------------------------------------------
2eh6A           LMLGLELERECK----------------------------------------------------------
3d46A           ----------------------------------------------------------------------
1cj0B           GGRAEKVLEACSIACNKNTCPGDKSALRPSGLR--LGTPALTSRGLLEKDFQKVAHFIHRGIELTVQIQD
1e9yA           ----------------------------------------------------------------------
3ei9A           APYVW-----VHFPNQSSWDVFAEILEKTH----VVTTPGSGFGPGGEGFVRVSAFGHRE--NILEACRR
2egyD           MFVWMELPKGLSAEGLFRRALEENVAFV-------------------PGGPFFANGGGENTLRLSYATLD
3ei9B           APYVW-----VHFPNQSSWDVFAEILEKTH----VVTTPGSGFGPGGEGFVRVSAFGHR---------EN
3ei7B           APYVW-----VHFPNQSSWDVFAEILEKTH----VVTTPGSGFGPGGEGFVRVSAFGHR---------EN
3bwnE           DAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLV-SELRRHKVMSRAGERCGSDKKHVRVSMLSDV
3eiaB           APYVW-----VHFPNQSSWDVFAEILEKTH----VVTTPGSGFGPGGEGFVRVSAFGHR---------EN
2bieB           RNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCR------------ASIYNAVPI---------DA
2egyB           MFVWMEL------PKGLSAEGLFRRALEEN-------------VAFVPGGPFFANGGGENTLRLSYATLD
3bh1D           ----------------------------------------------------------------------
3ei6B           APYVW-----VHFPNQSSWDVFAEILEKTH----VVTTPGSGFGPGGEGFVRVSAFGHR---------EN
1bw9A           ----------------------------------------------------------------------
3ei7A           APYVW-----VHFPNQSSWDVFAEILEKTH----VVTTPGSGFGPGGEGFVRVSAFGHRE--NILEACRR
3cbfA           MFVWMEL------PKGLSAEGLFRRALEEN----VAFVPGGPFFAN---------GGGENTLRLSYATLD
1bs0A           AIQPLIVGDNSR------ALQLAEKLRQQGCWVTAIRPPTV--------------PAGTARLRLTLTAAH
3e2fA           IIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSKSK--------PHFEKLVRFCFIK
1c1dA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ARDLIADLRQALEG
3e6gA           LGDLRGDLERA---
3e6gB           LGDLRGDLERA---
3e6gD           LGDLRGDLERA---
2ctzA           VEDLKAELKEAL--
2cb1A           PLDLLALFEEALE-
3cogD           EEDLLEDLDQALK-
1cs1A           GEDLIADLENGFR-
1cl1B           VDDLIADLDAGFA-
1cl1A           VDDLIADLDAGFA-
3d19B           --------------
3cogB           EEDLLEDLDQALK-
1ddzA           VRRHNQAELSRIT-
3d19C           --------------
3d19D           --------------
3bn1D           IDRVIAALDQVL--
1e5eA           ADELIADFKQGLD-
2c7tA           LSLLVDAVAELAR-
2c81A           GLHYPVSERASGQ-
3ecdA           DHATEQRVRREIF-
3ecdD           DHATEQRVRREIF-
3dr7B           IDRVIAALDQVL--
1e5eB           ADELIADFKQGLD-
3bcxA           LDYVVSKFEEFFG-
3dr4B           IDRVIAALDQVL--
3ecdC           DHATEQRVRREIF-
1ejiA           TKATLKEFKEKLA-
3bn1C           IDRVIAALDQVL--
3bcxB           LDYVVSKFEEFFG-
3dr4D           IDRVIAALDQVL--
1eg5B           TEEEVDYFLKKIE-
3dr4A           IDRVIAALDQVL--
3ecdB           DHATEQRVRREIF-
3bb8A           LDYVVSKFEEFFG-
3bwnA           DNVFLERLAN----
2dkjA           SEALREEVRRLAL-
1ecxA           TEEEVDYFLKKIE-
1ecxB           TEEEVDYFLKKIE-
1b9hA           LHATAEIIADAVA-
1c7gA           MDVVADGIIKLYQ-
3e9kA           VYKFTNLLTSILD-
3bn1A           IDRVIAALDQVL--
3dr4C           IDRVIAALDQVL--
1eg5A           VDYFLKKIEEILS-
1bj4A           DTGVAATLKEFKE-
2cy8A           FDRVLDRLADEN--
3bwnD           FNVFLERLAN----
3bcbA           VDLFIKRLDKCLN-
2aeuA           DNYIIKAIVESIK-
1c4kA           TPAKMNNLITQL--
2cfbA           IERTIAAARTVLS-
1c0nA           THEEVDRLVTGLQ-
3bcaA           VDLFIKRLDKCLN-
1ax4A           MDYIADALIGLKE-
2dgmE           AELLLEDYKASLK-
3b8xB           LFDEIDYLREVL--
2a7vA           KTAKLQDFKSFLL-
3b8xA           LFDEIDYLREVL--
2ch1A           --------------
2dr1A           IQEMLDNLREVIN-
2ch2A           --------------
2aevA           DNYIIKAIVESIK-
3dc1D           MDVAFQVLAQLIK-
2dgkA           AELLLEDYKASLK-
3bc8A           VDLFIKRLDKCLN-
2dgmB           AELLLEDYKASLK-
3d19E           --------------
2bwnD           DLKQIDGLVHAMD-
1b9iA           LHATAEIIADAVG-
1b8gB           LDLAMQRLKAFVG-
3d19A           --------------
2dgmA           AELLLEDYKASLK-
3e77C           VQKLAAFMKKFLE-
2bwnB           DLKQIDGLVHAMD-
3dc1B           MDVAFQVLAQLIK-
3b46A           LENAVERLKLLKD-
2bwnA           DLKQIDGLVHAMD-
3bwnB           -----DVFNVFLE-
3bwoC           -----DVFNVFLE-
2bwoD           DLKQIDGLVHAMD-
3bwnF           DNVFLERLANMKL-
2dgkC           AELLLEDYKASLK-
2bwoB           IDGLVHAMDLLWA-
2bwpA           IDGLVHAMDLLW--
1dfoB           DEAVIERIKGKVL-
3dydA           IQEFCEQHYH----
2dr1B           IQEMLDNLREVIN-
2dgmC           AELLLEDYKASLK-
3b46B           LENAVERLKLLKD-
1djpA           --------------
2c44B           MDFIIEAFKHVKE-
3e77A           VQKLAAFMKKFLE-
3caiA           TMAEVDQLVRALA-
1b8gA           LDLAMQRLKAFV--
2bwoA           IDGLVHAMDLLW--
2e7jA           --------------
2e54A           --------------
2bkwA           YKNCFDLIKLALQ-
3bwoA           -----DVFNVFLE-
2c44C           MDFIIEAFKHVKE-
3e77B           VQKLAAFMKKFLE-
1eghA           --------------
2c44A           MDFIIEAFKHVKE-
1b93B           --------------
2bwnE           IDGLVHAMDLLWA-
3cq5A           IIKL----------
2btwB           --------------
2btwA           --------------
3dzzB           VIDGQRLKQGVLN-
1bjwA           --------------
2bwpB           --------------
3bs8A           AEKVFAEISR----
1ajsA           IHEAVTKIQ-----
1djuB           MERVLKERKL----
3bh1C           --------------
1cj0A           DTGPRATLKEFKEK
1ay4B           --------------
1c7nA           LNKALKDLK-----
1c8nA           --------------
1dtyA           --------------
1d2fB           LEKGVAGLINAIR-
1djuA           LEEAMERMERVLK-
1agxA           --------------
2eh6A           --------------
3d46A           --------------
1cj0B           DTGPRATLKEFKEK
1e9yA           --------------
3ei9A           FKQLYKHHHH----
2egyD           REGIAEGVRRALKG
3ei9B           ILEACRRFKQLYK-
3ei7B           ILEACRRFKQLYK-
3bwnE           FNVFLERLANMKL-
3eiaB           ILEACRRFKQLYK-
2bieB           CIALRELMIQFKE-
2egyB           REGIAEGVRRALKG
3bh1D           --------------
3ei6B           ILEACRRFKQLYK-
1bw9A           --------------
3ei7A           FKQLYKHHHH----
3cbfA           REGIAEGVRRALKG
1bs0A           EMQDIDRLLEVLH-
3e2fA           KDSTLDAAEEIFR-
1c1dA           --------------