[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56707.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dikA.bssp"
#ERROR : Can't open dsspfile "2dikA.bssp"
#ERROR : Can't open dsspfile "2bg5A.bssp"
#ERROR : Can't open dsspfile "3cv2A.bssp"
#ERROR : Can't open dsspfile "1a3xA.bssp"
#ERROR : Can't open dsspfile "1dxfA.bssp"
#ERROR : Can't open dsspfile "1a3wA.bssp"
#ERROR : Can't open dsspfile "3cv2B.bssp"
#ERROR : Can't open dsspfile "3cuzA.bssp"
#ERROR : Can't open dsspfile "3cuxA.bssp"
#ERROR : Can't open dsspfile "1dxeA.bssp"
#ERROR : Can't open dsspfile "1a3wB.bssp"
#ERROR : Can't open dsspfile "3e5bD.bssp"
#ERROR : Can't open dsspfile "2e28A.bssp"
#ERROR : Can't open dsspfile "3bjfA.bssp"
#ERROR : Can't open dsspfile "3e5bC.bssp"
#ERROR : Can't open dsspfile "3e0vB.bssp"
#ERROR : Can't open dsspfile "1a49A.bssp"
#ERROR : Can't open dsspfile "1aqfE.bssp"

## Summary of PDB Search
:289
    1e-27  19%  1dikA  [x.x.x] PYRUVATE PHOSPHATE DIKINASE
    6e-25  20%  2dikA  [d.142.1 - c.8.1 - c.1.12] PROTEIN (PYRUVATE PHOSPHATE
    2e-20  21%  2bg5A  [x.x.x] PHOSPHOENOLPYRUVATE-PROTEIN KINASE
    4e-11  14%  3cv2A  [x.x.x] MALATE SYNTHASE A
    2e-10  16%  1a3xA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    2e-09  14%  1dxfA  [c.1.12] 2-DEHYDRO-3-DEOXY-GALACTARATE ALDOLASE
    7e-09  20%  1a3wA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    8e-09  17%  3cv2B  [x.x.x] MALATE SYNTHASE A
    1e-08  17%  3cuzA  [x.x.x] MALATE SYNTHASE A
    3e-08  15%  3cuxA  [x.x.x] MALATE SYNTHASE
    5e-08  16%  1dxeA  [c.1.12] 2-DEHYDRO-3-DEOXY-GALACTARATE ALDOLASE
    6e-08  19%  1a3wB  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    3e-06   8%  3e5bD  [x.x.x] ISOCITRATE LYASE
    4e-06  16%  2e28A  [x.x.x] PYRUVATE KINASE
    5e-06  12%  3bjfA  [x.x.x] PYRUVATE KINASE ISOZYMES M1/M2
    3e-05   9%  3e5bC  [x.x.x] ISOCITRATE LYASE
    3e-05  12%  3e0vB  [x.x.x] PYRUVATE KINASE
    3e-05  12%  1a49A  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    4e-05  15%  1aqfE  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRNQLALSGEKILEKIYPQLFHHVGMIRGEYLLRELNQNIILASCQQFVKDYLETICSLYSDEEVWYRFT
1dikA           -RTEHMFFEADRIMKIRKMILSDSVEAREEALNELIPFQK--GDFKAMYKALEGTVRYLHTEEEQA-ELA
2dikA           CRTEHMFFEADRIMKIRKMILSDSVEAREEALNELIPFQK--GDFKAMYKALEGTVRYLDPPLHEFVPHT
2bg5A           ---------------------------------------------------------------PVTIRTL
3cv2A           -----------------------------------------------------------------EAGKI
1a3xA           ------------------------------------DDKIMYVDYKNITKVISAGRIIYVDDGVLSFQVL
1dxfA           ----------------------------------------------------------------------
1a3wA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
3cuzA           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
1dxeA           ----------------------------------------------------------------------
1a3wB           ----------------------------------------------------------------------
3e5bD           ----------------------------------------------------------------DVMGTP
2e28A           ----------------------------------------------------------------------
3bjfA           ---------------------------------EKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVK
3e5bC           ----------------------------------------------------------------------
3e0vB           ----------------------------------------------------------------------
1a49A           ----------------------------------KCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVK
1aqfE           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLK
1dikA           KNMGLTLAEVKAKVDELHEFNPMMGHRGCRLAVTYPEVMEAAIEVKEETGIDI-VPEIMIPLVGEKKELK
2dikA           EEEQAELAEVKAKVDELHEFNPMMGHRGCRLAVTYPEVMEAAIEVKEETGIDI-VPEIMIPLVGEKKELK
2bg5A           D---------IGGDKELPYLDPFLGYRAIRLCLDRPDIFKTQLRAILRAS---AYGNVQIYPISSVEEVR
3cv2A           YQLKPNPAVLICRVRGLHLPEKHVTWRGEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAA
1a3xA           E--VVDDKTLKVKALNAGKICSHKGVNLPGVDLPALSEKDKED---LRFGVKNGVHMVFASFIRTANDVL
1dxfA           --------------------KRLLDIGFYNFLIPFVETKEEAELAVASTRY--PPEGIRGVSVSHRANFG
1a3wA           -----------------------------------LSEKDKEDLRF---GVKNGVHMVFASFIRTANDVL
3cv2B           --LKPNPAVLICRVRGLHLPEKHVTWRGEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAA
3cuzA           -----------------HLPEKHVTWRGEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAA
3cuxA           ---------------------------------------------------------FYLPKMESYLEAR
1dxeA           ------------------------------LIPFVETKEEAELAVASTRYP--PEGIRGVSVSHRANMFG
1a3wB           -----------------------------------------------------GVHMVFASFIRTANDVL
3e5bD           TLIVARTDAEAAKLDIDERDQPFVDYEAGRTAEGFYQVKIEPCIARAIAYAPYCDLIWMETSKPDLAQAR
2e28A           ---------------------------------------------------------IAASFVRRASDVL
3bjfA           QKGADFLVTEV---ENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVE-QDVDMVFASFIRKASDVH
3e5bC           -----------LTSDIDERDQPFVDYEAGRTAEGFYQVKNGIEPCIARAYAPYCDLIWMETSKPDLAQAR
3e0vB           ------------------TISDRRGVNLPGCDVDLPAVSAKDRVDL-QFGVEQGVDMIFASFIRSAEQVG
1a49A           QKGPDFLVTEV---ENGGFLGSKKGVNLPGAAVDLPAVSEKDIQDLKF-GVEQDVDMVFASFIRKAADVH
1aqfE           ----------------------------------------DIQDLKFGVEQDVDMVFA--SFIRKAADVH


                         +         .         .         .         .         *         .:210
query           QAITALRQYGFTGKVGTMIELPSAYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDLESPIMLDM
1dikA           EQVKKEKGSDMQYHIGTMIEIPRAALTADAIAEEAEF-FSFGTNDLTQMTFGFSRDDAGKFLDSTGVGQL
2dikA           EQVKKEKGSDMQYHIGTMIEIPRAALTADAIAEEAEF-FSFGTNDLTQMTFGFSRDDAGKFLDSTGVGQL
2bg5A           KANSILEEVKAELIKVGIVEIPSAAVTADILAK-EVDFFSIGTNDLTQYTLAVDRNKEYYQPFHPAILRL
3cv2A           WWSEVFSYARGTIKATLLIETLPAVFQMDEILHAHIVGLNCGRWDYIFSYIKTLKNYPDRTMDKPFLNAY
1a3xA           TIREVLGEQGKDVKIIVKIENQQGVNNFDEILKV-TDGVMVARGDLG------------IEIPAPEVLAV
1dxfA           TVADYFAQSNKNITILVQIESQQGVDNVDAIAATGVDGIFVGPSDLAAALGHL------GNASHPDVQKA
1a3wA           TIREVLGEQGKDVKIIVKIENQQGVNNFDEILK-VTDGVMVARGDLGIEIPA------------PEVLAV
3cv2B           WWEDRFNLPRGTIKATLLIETLPAVFQMDEILHAHIVGLNCGRWDYIFSYIKTLKNYQAVTMDKPFLNAY
3cuzA           WWSYAEDRFNLPRKATLLIETLPAVFQMDEILRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQAVTM
3cuxA           LWNDVFVFANGTIKATVLLETIHASFEMDEILYDHSAGLNCGRWDYIFSFLKAFRNHNEFLLPDRAQVTM
1dxeA           TVADYFAQSNKNITILVQIESQQGVDNVDAIATEGVDGIFVGPSDLA----AALGHL--GNASHPDVQKA
1a3wB           TIREVLGEQGKDVKIIVKIENQQGVNNFDEILK-VTDGVMVARGDLGIEIPA------------PEVLAV
3e5bD           RFAEAVHKAHPGKNWKKNLDDATIAKFQRELGAMGYKFQFITLLNYGMFELARGYKDAAYSELQQAEFAA
2e28A           EIRELLEAHDLHIQIIAKIENEEGVANIDEILE-AADGLMVARGDLGV------------EIPAEEVPLI
3bjfA           EVRKVLGEKGKNIKIISKIENHEGVRRFDEILEA-SDGIMVARGDLGIEIPAEKVFLRCNRAGKPVICAT
3e5bC           RFAEAVHKAHPGKNWKKNLDDATIAKFQRELGAMGITLAGFHQLNYGMFELARKDRQMAASELQQAEFAA
3e0vB           DVRKALGPKGRDIMIICKIENHQGVQNIDSIIEE-SDGIMVARGD------------LGVEIPAEKVVVA
1a49A           EVRKILGEKGKNIKIISKIENHEGVRRFDEI-----------LEASDGIMVARGDLGIEIPAEK--VFLA
1aqfE           EVRKILGEKGKNIKIISKIENHEGVRRFDEILE-ASDGIMVARGDLG------------IEIPAEKVFLA


                         .         .         .         +         .         .         .:280
query           LRDMQDKARKNKINFAVAGYLNTSFIQKMNQLGIKCIIHYSSIPEIFDLEIDHPDHLKHIKEESKKLQRS
1dikA           VEMAVKKGRQTRLKCGICGEHDPSSVEFCHKVGLNYVCSPFRVP--------------------------
2dikA           VEMAVKKGRQTRLKCGICGEHDPSSVEFCHKVGLNYVCSPFRVP--------------------------
2bg5A           VKVIDAAHKEGKFAAGEAG--DPLAAVILLGLGLDEFSSATSIPEI------------------------
3cv2A           SRLLIKTCHK------------------------------------------------------------
1a3xA           QKKLIAKSNLAGKPVICATQMLESMTYN------------------------------------------
1dxfA           IQHIFNRASAHGKPSGILA---------------------------------------------------
1a3wA           QKKLIAKSNLAGKPVICATQMLESMTYN------------------------------------------
3cv2B           SRLLIKTCHKRGA-FAMGGM--AAFIPSKD----------------------------------------
3cuzA           DKPFLNAYSRLLIKFAMGGM--AAFIPSKD----------------------------------------
3cuxA           TAVIQTCHRRNAPAIGEKVRADKEREALDGHDGTWV-AHPGLVPVAM----EVFNHIMKTPNQIFRKREE
1dxeA           IQHIFNRASAHGKPSGILA---------------------------------------------------
1a3wB           QKKLIAKSNLAGKPVICATQMLESMTYN------------------------------------------
3e5bD           EADGYTATKHQREVGTGYF---------------------------------------------------
2e28A           QKLLIKKSNMLGKPVITAT---------------------------------------------------
3bjfA           QMESMIKKPRPTRAEGSDVANAVLDGADCIML--SGETAKGDYPLEAVRMQNLIAREAEAAIYHLQLFEE
3e5bC           EADGYTATKHQREVGTGYF---------------------------------------------------
3e0vB           QKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKG-----------
1a49A           QKMIIGRCNR-------AGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGE--------
1aqfE           QKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKG-----------


                         .         *         .         .         .         .         +:350
query           THDTARNVE
1dikA           ---------
2dikA           ---------
2bg5A           ---------
3cv2A           ---------
1a3xA           ---------
1dxfA           ---------
1a3wA           ---------
3cv2B           ---------
3cuzA           ---------
3cuxA           IHVTEKDLL
1dxeA           ---------
1a3wB           ---------
3e5bD           ---------
2e28A           ---------
3bjfA           LR-------
3e5bC           ---------
3e0vB           ---------
1a49A           ---------
1aqfE           ---------