[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF56712.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b3dB.bssp"
#ERROR : Can't open dsspfile "1a80A.bssp"
#ERROR : Can't open dsspfile "3b3dA.bssp"
#ERROR : Can't open dsspfile "3d3fA.bssp"
#ERROR : Can't open dsspfile "1az1A.bssp"
#ERROR : Can't open dsspfile "2alrA.bssp"
#ERROR : Can't open dsspfile "1c9wA.bssp"
#ERROR : Can't open dsspfile "2dv0A.bssp"
#ERROR : Can't open dsspfile "2bgqA.bssp"
#ERROR : Can't open dsspfile "2bgsA.bssp"
#ERROR : Can't open dsspfile "2acsA.bssp"
#ERROR : Can't open dsspfile "1afsA.bssp"
#ERROR : Can't open dsspfile "2acuA.bssp"
#ERROR : Can't open dsspfile "3caqB.bssp"
#ERROR : Can't open dsspfile "1adsA.bssp"
#ERROR : Can't open dsspfile "3cv6A.bssp"
#ERROR : Can't open dsspfile "3c3uA.bssp"
#ERROR : Can't open dsspfile "1ah3A.bssp"
#ERROR : Can't open dsspfile "3burA.bssp"
#ERROR : Can't open dsspfile "2agtA.bssp"
#ERROR : Can't open dsspfile "3cv7A.bssp"
#ERROR : Can't open dsspfile "1ah0A.bssp"
#ERROR : Can't open dsspfile "3eauA.bssp"
#ERROR : Can't open dsspfile "3eb4A.bssp"
#ERROR : Can't open dsspfile "3eb3A.bssp"
#ERROR : Can't open dsspfile "2ao0A.bssp"
#ERROR : Can't open dsspfile "1dqaD.bssp"
#ERROR : Can't open dsspfile "1dqaB.bssp"
#ERROR : Can't open dsspfile "2c91B.bssp"
#ERROR : Can't open dsspfile "1dq8D.bssp"
#ERROR : Can't open dsspfile "3cd5C.bssp"
#ERROR : Can't open dsspfile "2c91A.bssp"
#ERROR : Can't open dsspfile "1dq9B.bssp"
#ERROR : Can't open dsspfile "2bp1B.bssp"
#ERROR : Can't open dsspfile "1dq8B.bssp"
#ERROR : Can't open dsspfile "1dq9C.bssp"
#ERROR : Can't open dsspfile "2bp1A.bssp"
#ERROR : Can't open dsspfile "3cdaA.bssp"
#ERROR : Can't open dsspfile "2clpA.bssp"
#ERROR : Can't open dsspfile "2aicA.bssp"
#ERROR : Can't open dsspfile "3cctC.bssp"
#ERROR : Can't open dsspfile "1dq8C.bssp"
#ERROR : Can't open dsspfile "3bglD.bssp"
#ERROR : Can't open dsspfile "3cdbC.bssp"
#ERROR : Can't open dsspfile "2clpI.bssp"
#ERROR : Can't open dsspfile "1dq8A.bssp"
#ERROR : Can't open dsspfile "3cd5D.bssp"
#ERROR : Can't open dsspfile "3cdaD.bssp"
#ERROR : Can't open dsspfile "2d4cA.bssp"
#ERROR : Can't open dsspfile "2d4cB.bssp"
#ERROR : Can't open dsspfile "3cd0D.bssp"
#ERROR : Can't open dsspfile "1dq9D.bssp"
#ERROR : Can't open dsspfile "1dy1A.bssp"
#ERROR : Can't open dsspfile "2d4cC.bssp"
#ERROR : Can't open dsspfile "1dy0A.bssp"
#ERROR : Can't open dsspfile "3ee8B.bssp"
#ERROR : Can't open dsspfile "1dqaC.bssp"
#ERROR : Can't open dsspfile "3ee8A.bssp"
#ERROR : Can't open dsspfile "3bmaF.bssp"

## Summary of PDB Search
:280
    9e-71  47%  3b3dB  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    8e-70  44%  1a80A  [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    4e-69  47%  3b3dA  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    2e-66  51%  3d3fA  [x.x.x] YVGN PROTEIN
    2e-63  37%  1az1A  [x.x.x] ALDOSE REDUCTASE
    5e-63  40%  2alrA  [x.x.x] ALDEHYDE REDUCTASE
    7e-63  35%  1c9wA  [c.1.7] CHO REDUCTASE
    9e-63  36%  2dv0A  [x.x.x] ALDOSE REDUCTASE
    6e-62  36%  2bgqA  [x.x.x] ALDOSE REDUCTASE
    1e-61  36%  2bgsA  [x.x.x] ALDOSE REDUCTASE
    3e-61  36%  2acsA  [x.x.x] ALDOSE REDUCTASE
    5e-61  32%  1afsA  [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    8e-61  37%  2acuA  [x.x.x] ALDOSE REDUCTASE
    4e-60  33%  3caqB  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    4e-60  35%  1adsA  [c.1.7 (1ef3A)] ALDOSE REDUCTASE
    5e-60  33%  3cv6A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21
    9e-60  36%  3c3uA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    1e-59  35%  1ah3A  [c.1.7 (1ekoA)] ALDOSE REDUCTASE
    9e-59  31%  3burA  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    9e-57  39%  2agtA  [x.x.x] ALDOSE REDUCTASE
    1e-56  38%  3cv7A  [x.x.x] ALCOHOL DEHYDROGENASE
    2e-56  34%  1ah0A  [x.x.x] ALDOSE REDUCTASE
    2e-54  26%  3eauA  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    1e-53  24%  3eb4A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    2e-53  24%  3eb3A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    4e-50  38%  2ao0A  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-47   9%  1dqaD  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    2e-47  10%  1dqaB  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    7e-46  24%  2c91B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    1e-45  10%  1dq8D  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    6e-45  10%  3cd5C  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    8e-45  21%  2c91A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    1e-44  10%  1dq9B  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    2e-44  22%  2bp1B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    2e-44  10%  1dq8B  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    4e-44  11%  1dq9C  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    5e-44  22%  2bp1A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    7e-44   9%  3cdaA  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    3e-43  23%  2clpA  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    3e-43  15%  2aicA  [x.x.x] GUANINE NUCLEOTIDE EXCHANGE FACTOR BOPE
    6e-43   9%  3cctC  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    3e-42   9%  1dq8C  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    8e-42  10%  3bglD  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    4e-41   9%  3cdbC  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    4e-41  23%  2clpI  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    3e-40   9%  1dq8A  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    5e-40   9%  3cd5D  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    1e-33  11%  3cdaD  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    5e-33  15%  2d4cA  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    3e-32  17%  2d4cB  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    6e-32  10%  3cd0D  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    7e-30  11%  1dq9D  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    2e-29  13%  1dy1A  [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN
    1e-28  16%  2d4cC  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    4e-28  13%  1dy0A  [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN
    2e-22   7%  3ee8B  [x.x.x] NON-STRUCTURAL PROTEIN 1
    7e-21   9%  1dqaC  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    6e-19  11%  3ee8A  [x.x.x] NON-STRUCTURAL PROTEIN 1
    7e-11  12%  3bmaF  [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
:280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDTYQLNNGVEIPVLGFGTFKAKDGEEAYRAVLEALKAGYRHIDTAAIYQNEESVGQAIKDSGVPREELF
3b3dB           --KATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGIREAGISREDLF
1a80A           VPSIVLNDGNSIPQLGYGVFKV-PPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLF
3b3dA           --KATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGIREAGISREDLF
3d3fA           --TVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREELF
1az1A           --RLLLNNGAKMPILGLGTWKS-PPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEQVVKREELF
2alrA           --CVLLHTGQKMPLIGLGTWKS-EPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKGKAVPREELF
1c9wA           -TFVELSTKAKMPIVGLGTWQS-PPGQVKEAVKVAIDAGYRHIDCAYAYYNGEAIQEKIKEKAVRREDLF
2dv0A           --RILLNNGAKMPILGLGTWKS-PPGQVTEAVKVAIDVGYRHIDCAHVYQNENEIQEKLREQVVKREELF
2bgqA           QDHFVLKSGHAMPAVGLGTW-----DTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLKEAGIDRKDLF
2bgsA           --HFVLKSGHAMPAVGLGTWRAGS-DTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLKEAGIDRKDLF
2acsA           --RLLLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVQEKLREQVVKREELF
1afsA           --RVALNDGNFIPVLGFGTTVPVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGSKIEDGTVKREDIF
2acuA           --RLLLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVHQNENEVGVAIQEQVVKREELF
3caqB           --RIPLSDGNSIPIIGLGTYSSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIAEGKVRREDIF
1adsA           --RLLLNNGAKMPILGLGTWKS-PPGQVTEAVKVAIDVGYRHIDCAHVYQNENEIQEKLREQVVKREELF
3cv6A           CHCVILNDGNFIPVLGFGTALPCPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRDGTVRREDIF
3c3uA           YQCVKLNDGHFMPVLGFGTYAPAEVSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
1ah3A           --HLVLYTGAKMPILGLGTWKSPP-GKVTEAVKVAIDLGYRHIDCAHVYQNGLGLQEKLQGQVVKREDLF
3burA           --RIPLSDGNSIPIIGLGTYSETPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREGKVRREDIF
2agtA           --RILLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEQVVKREELF
3cv7A           --CVLLHTGQKMPLIGLGTWKS-EPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVVPREELF
1ah0A           --HLVLYTGAKMPILGLGTWKS-PPGKVTEAVKVAIDLGYRHIDCAHVYQNGLGLQEKLQGQVVKREDLF
3eauA           QFYRNLKSGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYAAEVVLGNIIKKKGWRRSSLV
3eb4A           QFYRNLKSGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYAAGKALGNIIKKKGWRRSSLV
3eb3A           QFYRNLKSGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYAAEVVLGNIIKKKGWRRSSLV
2ao0A           --ASCLHTGQKMPLIGLGTWKSE-PGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVVPREELF
1dqaD           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
1dqaB           CRAIGLGGGASSRVLADGMTRGACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAGRNLY
2c91B           ------------PATVLGTMERMDASASAASVRAFLERGHSELDTAFMYCDGQSEN-ILGGLGLGDCTVK
1dq8D           CRAIGLGGGASSRVLADGMTRGPLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
3cd5C           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTAGRNLY
2c91A           ----------LRPATVLGTMERMDASASAASVRAFLERGHSELDTAFMYCDGQSEN-ILGGLGLGDCTVK
1dq9B           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
2bp1B           ------------VASVLGTMERMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETIGLGLGLGCRVKIA
1dq8B           CRAIGLGGGASSRVLADGMTRGPLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
1dq9C           ----GLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
2bp1A           ------------VASVLGTMERMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGGGGDCRVK
3cdaA           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
2clpA           ------------PATVLGAMERMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSET-ILGGLGLSDCRVK
2aicA           -------------------------------------------------------GDAKQ---AIRHFVD
3cctC           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
1dq8C           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
3bglD           CRAIGLGGGASSRVLADGMTRGPLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
3cdbC           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
2clpI           ------------PATVLGAMERMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSET-ILGGLGLSDCRVK
1dq8A           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
3cd5D           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
3cdaD           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
2d4cA           -----MTKTIEYLQPNPASRAKLYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLD
2d4cB           ------------PASRAKLSMIPGYPQAEALLAEAMLKFGRELGDDCNFGPLGEVGEAMRELSEVKDSLD
3cd0D           CRAIGLGGGASSRVLADGMTRGRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
1dq9D           CRAIGLGGGASSRVLATRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHIAGRNLY
1dy1A           ----------------------------------------------------------------------
2d4cC           MEIMTKTIEYLQPNPASRAKLPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLD
1dy0A           ----------------------------------------------------------------------
3ee8B           ----------------------------------------------------------------------
1dqaC           --------------TRGPVVRLPRACDS--AEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTAGRNLY
3ee8A           ----------------------------------------------------------------------
3bmaF           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VTTKLWNSQQTYEQARQAFEESLEKLGLDYLDLYLIHWPNPKPLRENDQWKIRNAEVWRAMEDLYQEGKI
3b3dB           ITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKE----------AWRALETLYKEGRI
1a80A           ITTKLWNDRHDGDEPAAAIAESLAKLALDQVDLYLVHWP--------TPAADNYVHAWEKMIELRAAGLT
3b3dA           ITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWP----------VEGKYKEAWRALETLYKEGRI
3d3fA           ITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDT----------WRALEKLYKDGKI
1az1A           IVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEVPSDTNILDTWAAMEELVDEGLV
2alrA           VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGETWKALEALVAKGLV
1c9wA           IVSKLWPTCFERKLLKEAFQKTLTDLKLDYLDLYLIHWPQGQPGKEVLTSKITFLDAWEVMEELVDEGLV
2dv0A           IVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEVPSDTNILDTWAAMEELVDEGLV
2bgqA           VTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWPFRLKDGAHMPPEAGEEGVWKEMENLVKDGLV
2bgsA           VTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWPFRLKDGAHMPPEAGEEGVWKEMENLVKDGLV
2acsA           IVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKVVPSDTNILDTWAAMEELVDEGLV
1afsA           YTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMADEHGKLLFETVDICDTWEAMEKCKDAGLA
2acuA           IVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKVVPSDTNILDTWAAMEELVDEGLV
3caqB           YCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMADENGKWLYHKSNLCATWEAMEACKDAGLV
1adsA           IVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEVPSDTNILDTWAAMEELVDEGLV
3cv6A           YTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMADEHGKLIFDRVDLCATWEAMEKCKDAGLT
3c3uA           YTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVPKDENGKITVDLCATWEAVEKCKDAGLA
1ah3A           IVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPPDESDFVETWEAMEELVDEGLV
3burA           YCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFENGKWLYHKSNLCATWEAMEACKDAGLV
2agtA           IVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGKPGKEVVPSDTNILDTWAAMEELVDEGLV
3cv7A           VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGDTWKALEALVAKGLV
1ah0A           IVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPFPLDGDVETWEAMEELVDEGLV
3eauA           ITTKIFWGGKSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
3eb4A           ITTKIFWGGKSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
3eb3A           ITTKIFAGGKSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
2ao0A           VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGDTWKALEALVAKGLV
1dqaD           IRFQSRSGDAMGNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDK----------KPAAINWIEGRGKS
1dqaB           IRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDK----------KPAAINWIEGRGKS
2c91B           IATKANPWEGKPDSIRSQLETSLKRLQCPRVDLFYLHAPDHSTPVE---------ETLCACHQLHQEGKF
1dq8D           IRFQSRSGDAMGNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDK----------KPAAINWIEGRGKS
3cd5C           IRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDK----------KPAAINWIEGRGKS
2c91A           IATKANPWEGKPDSIRSQLETSLKRLQCPRVDLFYLHAPDHSTPVE---------ETLCACHQLHQEGKF
1dq9B           IRFQSRSGDAMGNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDK----------KPAAINWIEGRGKS
2bp1B           TKANPWDGKLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDH---------GTPVEETLHACQRLHQEGKF
1dq8B           IRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKK----------PAAINWIEGRGKS
1dq9C           IRFQSRSGDAMMNMISKGTEKALSKLHEYFPEMQILAVSGN----------YCTDKKPAAINWIEGRGKS
2bp1A           IATKANPWDGKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHG---------TPVEETLHACQRLHQEGKF
3cdaA           IRFQSRSGDAMMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDK----------KPAAINWIEGRGKS
2clpA           IDTKAIGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVE---------ETLRACHQLHQEGKF
2aicA           EAVKQPEIRQDAEFGRQVYEATLCAIFSEAKDRFCMDPATRGNVRPAFIEALGDAARATGLPGADKQGVF
3cctC           IRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVS----------GNYCTDKKPAAINWIEGRGKS
1dq8C           IRFQSRSGDAMGNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDK----------KPAAINWIEGRGKS
3bglD           IRFQSRSGDAMGNMISKGTEKALSKLHEYFPEMQILAVSGN----------YCTDKKPAAINWIEGRGKS
3cdbC           IRFQSRSGDAMMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKK----------PAAINWIEGRGKS
2clpI           IDTKAFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVE---------ETLRACHQLHQEGKF
1dq8A           IRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKK----------PAAINWIEGRGKS
3cd5D           IRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGN----------YCTDKKPAAINWIEGRGKS
3cdaD           IRFQSRSGDAMGNMISKGTEKALSKLHEYFPEMQILAVSGNYCTD----------KKPAAINWIEGRGKS
2d4cA           IEVLQNLHDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQGKIPDE---------ELRQALEKFDESKEI
2d4cB           IEVKQNLHDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQ---------GKIPDEELRQALEKFDESKEI
3cd0D           IRFQSRSGDAMMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTD----------KKPAAINWIEGRGKS
1dq9D           IRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKVCEAVIPAKVVREVLKTTTEAMI
1dy1A           ---------------------------------PLAHTHQDFQP----------VLHLVALNTP-LSGGM
2d4cC           IEVKQNFIDPLQREIQSALQHHLKKLEGRRLDFDYKKKRQGKIPDE---------ELRQALEKFDESKEI
1dy0A           ------------------------------------HTHQDFQP----------VLHLVALNTP-LSGGM
3ee8B           --------------------------------------PASRYITD---MTI-EELSRDWFMLMPKQKVE
1dqaC           IRFQSRSGDAMGMNMSKGTEKALSKLHEYFPEMQILAVSGNYCTDK----------KPAAINWIEGRGKS
3ee8A           --------------------------------------PASRYITDMT----IEELSRDWFMLMPKQKVE
3bmaF           -----------------------------HHNLGAEKRSAVATID----------SFKERKVRALSDPNV


                         +         .         .         .         .         *         .:210
query           RAIGVSNFLPHHLDALLETAKILPAVNQVRLAPGVYQDQVVAYCREKGILLEAWGPFGQGELFDSKQVQE
3b3dB           KAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLAD
1a80A           RSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQYDLFGAEPVTA
3b3dA           KAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLAD
3d3fA           RAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQGQLLDNEVLTQ
1az1A           KAIGISNFNHLQVEMILNKPGLKYKPAVNQIHPYLTQEKLIQYCQSKGIVVTAYSPLGSPSLLEDPRIKA
2alrA           QALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGV--LLEEPVVLA
1c9wA           KALGVSNFNHFQIERILNKPGLKHKPVTNQCHPYLTQEKLIEYCHSKGITVTAYSPLGSPSLLEDPKIKE
2dv0A           KAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQLIQYCQSKGIVVTAYSPLGSPSLLEDPRIKA
2bgqA           KDIGVCNYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGKN-LAHDPVVEK
2bgsA           KDIGVCNYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGSSEKAHDPVVEK
2acsA           KAIGISNFNHLQVEMILNKPGLKYKPAVNQCHPYLTQEKLIQYCQSKGIVVTAYSPLGSPSLLEDPRIKA
1afsA           KSIGVSNFNCRQLERILNKPGLKYKPVCNQCHLYLNQSKMLDYCKSKDIILVSYCTLGSSVLLDDPVLCA
2acuA           KAIGISNFNHLQVEMILNKPGLKYKPAVNECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPSLLEDPRIKA
3caqB           KSLGVSNFNRRQLELILNKPKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTPPLLKDALLNS
1adsA           KAIGISNFNHLQVEMILNKPGLKYKPAVNQCHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPEDPRIKA
3cv6A           KSIGVSNFNYRQLEMILNKPGLKYKPVCNQVHPYLNQMKLLDFCKSKDIVLVAYGVLGTQVLLDEPVLGS
3c3uA           KSIGVSNFNRRQLEMILNKPGLKYKPVCNQCHPYFNQRKLLDFCKSKDIVLVAYSALGSHRELEDPVLCA
1ah3A           KAIGVSNFNHLQVEKILNKPGLKYKPAVNQVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPSLLEDPRIKA
3burA           KSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQLLKFCQQHDIVITAYSPLGTSPLLKDALLNS
2agtA           KAIGISNFNHLQVEMILNKPGLKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPSLLEDPRIKA
3cv7A           RALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSVLLEEPVVQA
1ah0A           KAIGVSNFNHLQVEKILNKPGLKYKPAVNQIHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPEDPRIKA
3eauA           MYWGTSRWSSMEIMEAYSVARIPPICEQAEYHMEKVEVQLPELFHKIGVGAMTWSPLACGQQAKLKELQA
3eb4A           MYWGTSRWSSMEIMEAYSVARQFNLIPPRCEQAEKVEVQLPELFHKIGVGAMTWSPLACGIVAKLKELQA
3eb3A           MYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEKVEVQLPELFHKIGVGAMTWSPLACGIVSKLKELQA
2ao0A           RALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSVLLEEPVVQA
1dqaD           VVCAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSGYNAHAANIVTAIYIACGQDAAQNVSIEIGT
1dqaB           VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMIGGYNAHAANIVTAIYIACGQDACTMPSIEIGT
2c91B           VELGLSNYASWEVAEICTLCKILPTVYQGMYNATTRQVELLPCLRHFGLRFYAYNPLAGGLLTGKKALQT
1dq8D           VCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIEDLYISCTMPSIEIGT
3cd5C           VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGAGSIGGYNAHAANIVTAIYIACGQDACTMPSIEIGT
2c91A           VELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYVEAELLPCLRHFGLRFYAYNPLAGGLLLVEKALQT
1dq9B           VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMIGGYNAHAANIVTAIYIACGQDAAQNVSIEIGT
2bp1B           VELGLSNYASWEVAEICTLCKILPTVYQGMYNATTRQVELFPCLRHFGLRFYAYNPLAGGLLTGKKALQA
1dq8B           VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGAGSIGGYNAHAANIVTAIYIACGQDACTMPSIEIGT
1dq9C           VVCEAVIPAKVVREVLKTTTAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACNEDLYISIEIGT
2bp1A           VELGLSNYASWEVAEICTLCKILPTVYQGMYNATTRQTELFPCLRHFGLRFYAYNPLAGGLLTGKKALQA
3cdaA           VCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAGSIGGYNAHAANIVTAPTNEDLYISCTMPSIEIGT
2clpA           VELGLSNYAAWEVAEICTLCKILPTVYQGMYNAITRQTELFPCLRHFGLRFYAFNPLAGGLLEDKDGKQP
2aicA           TPSGAGTNPLYTEIRLRADTELAARPEYRELQPYQAIDLVANALPAERSNTLVEFRQTVQTLRRAAQDAS
3cctC           VVEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAIGGYNAHAANIVTAIYIACGQDAAQNVSIEIGT
1dq8C           VVEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAGSIGGYNAHAANIVTAIYIACGQDACTMPSIEIGT
3bglD           VVEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAPSIEIGT
3cdbC           VVCAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGNAHAANIVTAIYIACGQDACTMPSIEIGT
2clpI           VELGLSNYAAWEVAEICTLCKILPTVYQGMYNAITRQTELFPCLRHFGLRFYAFNPLAGGLLEDKDGKQP
1dq8A           VVCAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSGYNAHAANIVTAIYIACGQDAAQNPSIEIGT
3cd5D           VVCAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGNAHAANIVTAIYIACGQDACTMPSIEIGT
3cdaD           VVCEAVIPAKREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNC
2d4cA           AESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIR---------------------
2d4cB           AESSMFNLLEMDIEQVSQLSA--LVQAQLEYHKQAVQQQVTVRLEERIR---------------------
3cd0D           VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGGYNAHAANIVTAIYIACLYISCTMPSIEIGT
1dq9D           EVNINKNLVGSAMAGSIGGANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGT
1dy1A           RGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSRRADRGSVPIVNLKDEVLSPSWDSLFSGSSVWHG
2d4cC           AESSMFNLLEMDIEQVSQLSA--LVQAQLEKQAVQILQQVTVRLEERIR---------------------
1dy0A           RGIRGADFQCFQQARAVGLSGTFRAFLSSGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGAWPQKSVWHG
3ee8B           GPLCIRIDQAIMD------KNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDIGV
1dqaC           VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGGYNAHAANIVTAIYIACGQNEDLMPSIEIGT
3ee8A           GPLCIRIDQAIMDK------NIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPS---FPGHTIED
3bmaF           RFVGSSEWLRFDGAHPAVLAEKYQGGAASLNQYFGMQQMQLENKQVVYVISPQWFGDQLTSFLKHQSVQK


                         .         .         .         +         .         .         .:280
query           IAANHGKSIAQIALAWSLAEGFLPLPKSVTTSRIQANLDCFGIELSHEERETLKTIAVQSGAPRVDDVDF
3b3dB           IAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALN-------------
1a80A           AAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMD-------------
3b3dA           IAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALN-------------
3d3fA           IAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALKDERVGPNPDELLF
1az1A           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN-------------
2alrA           LAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALN-------------
1c9wA           IAAKHKKTSAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATILGFN-------------
2dv0A           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN-------------
2bgqA           VANKLNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIK-------------
2bgsA           VANKLNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIK-------------
2acsA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSY--------------
1afsA           IAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLN-------------
2acuA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN-------------
3caqB           LGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALN-------------
1adsA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN-------------
3cv6A           MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLN-------------
3c3uA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-------------
1ah3A           IAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYN-------------
3burA           LGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALN-------------
2agtA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLS---
3cv7A           LAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPML---
1ah0A           IAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYN-------------
3eauA           IAERLGCTLPQLAIAWCLRGVSSVLLGASNAEQLMENIGAIQVKLSSSIVHEIDSIL-------------
3eb4A           IAERLGCTLPQLAIAWRNEGVSSVLLGASNAEQLMENIGAIQVKLSSSIVHEIDSIL-------------
3eb3A           IAERLGCTLPQLAIAWCLRGVSSVLLGASNAEQLMENIGAIQVKLSSSIVHEIDSIL-------------
2ao0A           LAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPML---
1dqaD           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKS---------
1dqaB           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKS---------
2c91B           TYGTNAPRMTSAALRWMYHRGDAVILGMSSLEQLEQNLAATEEPLEPAVVEAFDQA--------------
1dq8D           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA---------------
3cd5C           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAG--------------
2c91A           TYGTNAPRMTSAALRWMYHHSQLVILGMSSLEQLEQNLAATEEPLEPAVVEAFDQAW-------------
1dq9B           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVM-AGELSLMAA-----------------
2bp1B           AYGASAPSVTSAALRWMYHHGDAVILGMSSLEQLEQNLAATEEPLEPAVVDAFNQA---WHLVAHECPNY
1dq8B           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAG--------------
1dq9C           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKS---------
2bp1A           AYGASAPSVTSAALRWMYHHGDAVILGMSSLEQLEQNLAATEEPLEPAVVDAFNQA---WHLVAHECPNY
3cdaA           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAAL-----------------
2clpA           VGRFFGNTWAEMYRNRYWKEHHFEGIALV-EKALQAAYGASAPSYHHSQLQGAHGDAVILGMSSLEQLE-
2aicA           RDEKGATNAADGA---------------------------------------------------------
3cctC           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAAL-----------------
1dq8C           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVM-AGELSLMAA-----------------
3bglD           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAAL-----------------
3cdbC           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAG--------------
2clpI           VGRFFGNTWAEMYRNRYWKEHHFEGIALV-EKALQAAYGASAPSYHHSQLQGAHGDAVILGMSSLEQLE-
1dq8A           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAG--------------
3cd5D           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAAL-----------------
3cdaD           ITLMEASGPTN----EDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLA----
2d4cA           ----------------------------------------------------------------------
2d4cB           ----------------------------------------------------------------------
3cd0D           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTV----------------------------
1dq9D           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVC--GTVMAGEL---------------------
1dy1A           SDPSGRRLMESYCETWRTETTGSSLLSGRLLEQKAASCHNSYIVLCIEN---------------------
2d4cC           ----------------------------------------------------------------------
1dy0A           SDPSGRRLMESYCETWRTETTGSSLLSGRLLEQKAASCHNSYIVLCIEN---------------------
3ee8B           LIGGLEWNDNTVRVSKTL----------------------------------------------------
1dqaC           VGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA---------------
3ee8A           VKNAIGV------LIGGLEWN----DNTVRVSKLQRF---------------------------------
3bmaF           LASKEELSTADNEMIELLARFNERQASFFGQFSG-------YVNYDKHVAKYLKILPDQ-----------