[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF54777.1

[Show Plain Result]


## Summary of Sequence Search
    1::605
   70::214     8e-06  28%  343 aa  PF01757 Acyl_transf_3 "Acyltransferase family"
    1::605

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLIGFFRRRFY
PF01757         ------------------------------------------------------------LLSFYKRRLL


                         .         .         *         .         .         .         .:140
query           RIXXXXXXXXXXXXXFTFLVRQDYVAGIGGQIASVLGFMTNFYELLTGGSYESQFIPHLFVHNWSLAVEV
PF01757         RLLPPYLLALLLYLLLALLV-------LGGILANALALLALLWLLLLLGLNFLLGEPPPLGHLWSLSVEF


                         +         .         .         .         .         *         .:210
query           HYYILWGLAVWFLSKQAKSNGQLKGMVFLLSAVAFLISFFSMFIGSFLVTSYSSVYFSSLTHVYPFFLGS
PF01757         QFYLLFPLLLLLLRRLRRL------ALLLLLALLLLLSLLLLLL--LLFGPATSVFLLPLPSVLFFLLGA


                         .         .         .         +         .         .         .:280
query           MLATIVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01757         LLALLL----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01757         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01757         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01757         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01757         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01757         ---------------------------------------------