[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF54887.1

[Show Plain Result]


## Summary of Sequence Search
    1::99
    2::82      1e-07  40%   82 aa  PF02699 YajC "Preprotein translocase subunit"
    1::99

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxNITFLIMLVGMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTEKGTIVLDVD
PF02699         ---SMSLLPLVLIFVIFYFLIIRPQKKRQKEHKEMLSSLKKGDEVVTIGGIVGKVVKVDDD--TVVLEIE


                         .         .         *         .         .         .         .:140
query           GVYLTFELAAIKTVLxxxxxxxxxxxxxx
PF02699         GVEITVERSAIAAVL--------------