[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55075.1

[Show Plain Result]


## Summary of Sequence Search
    1::145
    1::83      3e-09  35%   83 aa  PF02082 Rrf2 "Transcriptional regulator"
    1::145

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGTEIVKDL
PF02082         MKLSSKTDYALRALLYLALHPGGGPVTSAEIAERLGISPSYLRKILAKLRKAGLVESVRGKGGYRLARPP


                         .         .         *         .         .         .         .:140
query           KDISLLDVYQAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02082         EEITLGDVVRAL----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxx
PF02082         -----