[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55106.1

[Show Plain Result]


## Summary of Sequence Search
    1::440
    1::187     2e-13  41%  187 aa  PF08245 Mur_ligase_M "Mur ligase middle domain"
    1::440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIGGTNGKGSTIAFLKKMLEKLGLRVGV
PF08245         -------------------------------------------VTGTNGKTTTTAMLAAILSAAGLRVGT


                         .         .         *         .         .         .         .:140
query           FSSPYLIHYTDQISINGESISEARLEALMADYQSLLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAI
PF08245         YG-----------------------------------------LNTNEEIGLPAALAL--LAEAGVDVAV


                         +         .         .         .         .         *         .:210
query           MEVGMGGLLDSTNVCQPILTGITTIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALTVIDRI
PF08245         LEVGSGGRLDAT-ILKPDVAVITNIGPDHLDRLG-TLEAIAAAKAGIFK--------RLPPDGVAVLNEL


                         .         .         .         +         .         .         .:280
query           AEEKDAPRLAYGTDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLxxxxxxxxxx
PF08245         AAKAGARVVTFGEDADVRADDITVSADGGAFTLVTPGGELEVTLPGRHNVYNALAAIAAL----------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08245         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08245         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxx
PF08245         --------------------