[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55169.1

[Show Plain Result]


## Summary of Sequence Search
    1::347
    2::232     6e-60  51%  232 aa  PF00198 2-oxoacid_dh "2-oxoacid dehydrogenases acyltransferase
    2::37      2e-06  53%   39 aa  PF02817 E3_binding "e3 binding domain"
    1::347

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00198         ----------------------------------------------------------------------
PF02817         ----EVKASPAVRKLARELGVDLSKVKGTGPGGRITKEDV------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKIERIPMTPMRKVIAQRMVESYLT
PF00198         ---------------------------------------------GEEERVPLSRMRKAIAKRMVESLQT
PF02817         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           APTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLLSLAVVKTLMKHPYINASLTEDGKTIITHNY
PF00198         IPHFTLFDEVDVTALMALRKELKEEF-EKKGGKLTFLPFLIKAVALALKEFPELNASIDGDGPTIVYKDY
PF02817         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VNLAMAVGMDNGLMTPVVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGP
PF00198         VNIGIAVDTPRGLVVPVIRDADTKSLAEIAKEIKDLAKKARDGKLTPEEMQGGTFTISNLGMFGGTYFTP
PF02817         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IINQPNSAILGVSSTIEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI
PF00198         IINPPQVAILGVGAIRKRPVVVDGEIVIRPMMPLSLSYDHRVIDGAEAARFLNTLKELLEDPERLLI
PF02817         -------------------------------------------------------------------