[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55178.1

[Show Plain Result]


## Summary of Sequence Search
    1::543
  106::230     1e-22  41%  256 aa  PF00069 Pkinase "Protein kinase domain"
  106::203     1e-15  38%  254 aa  PF07714 Pkinase_Tyr "Protein tyrosine kinase"
    3::62      5e-05  40%   63 aa  PF03793 PASTA "PASTA domain"
    1::543

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARG
PF00069         --QILRALAYLHSKGIIHRDLKPENILLDEDGNVKLIDFGLA-KLLLSSGERLTTVVGTPGYMAPEVLLG
PF07714         --QIARGLEYLHSKKIIHRDLKARNILLDENLVAKISDFGLALLYSDDYYHVSTRVKGPIGWMAPEYLRT
PF03793         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVPQxxxxxxxxxxxxxxx
PF00069         GGYTKKVDIWSLGVILYELLTGRPPFDGESQLELIEKILGGPLPFPLPESDSSPE---------------
PF07714         GKFTEKSDVYSFGVLLWEILTGRRPYPG------------------------------------------
PF03793         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIPDVAGQTVAEAKATLKKANFEIGX
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF03793         ---------------------------------------------VPDVVGMTLDEAKETLEAAGLKVG-


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXXXGRIIRTDPGAGTGRKEGTKINLVVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF03793         IVEEYSDDVPKGTVISQSPAAGTKVKKGSKVTLTVS----------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         -----------------------------------------------------
PF07714         -----------------------------------------------------
PF03793         -----------------------------------------------------