[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55228.1

[Show Plain Result]


## Summary of Sequence Search
    1::230
   31::201     2e-18  34%  229 aa  PF01048 PNP_UDP_1 "Phosphorylase superfamily"
    1::230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDA
PF01048         -----------------------------GNTYTTGTIGGHNVVVASTGIGKVSAAIAATRLLKSFGVRL


                         .         .         *         .         .         .         .:140
query           LINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNW
PF01048         IIRVGICGGLNPDIRLGDVVVSTDVIQYDGGRPLTGPNEGGVRFPDLSAKADPELRAAAEEAAKELGPRV


                         +         .         .         .         .         *         .:210
query           HFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANxxxxxxxxxx
PF01048         HYGTIASGDGFYKSTRARDRLARKL-GALAVEMEAAGLAAVARENGVPCLVIRGISDYAD----------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxx
PF01048         --------------------