[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55245.1

[Show Plain Result]


## Summary of Sequence Search
    1::230
    7::206     2e-25  33%  208 aa  PF03070 TENA_THI-4 "TENA/THI-4/PQQC family"
    1::230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLADKTSNQEMKRL
PF03070         --------------WEAYTEHPFVQALADGTLPKEKFRYYLIQDYLYLKHFARYLALAAAKAPDLETRRE


                         .         .         *         .         .         .         .:140
query           LKQNAQGLVEGELFIRQQFFKELEISDQEMEQHPIAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYH
PF03070         LLENLLDEIGGELELHLRFAEALGLDREELENAEPLPATRAYVDYLLDVARSGSLLEGLAALLPCEWGYL


                         +         .         .         .         .         *         .:210
query           DIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWE
PF03070         EIGKRLELRLDEGAPYREWIDNYSSEEFEEAVEELEELLDELAASASEEEREELEEIFLKALELEYDFWD


                         .         .         .         +         .         .         .:280
query           MAxxxxxxxxxxxxxxxxxx
PF03070         MA------------------