[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55303.1

[Show Plain Result]


## Summary of Sequence Search
    1::816
   41::163     5e-17  42%  163 aa  PF00929 Exonuc_X-T "Exonuclease"
   18::72      2e-05  48%  167 aa  PF00270 DEAD "DEAD/DEAH box helicase"
    1::816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVNPHEPLDAHIKELTGLTDQRLAQAP
PF00929         --------------------------------------------VKPERPISPFATELHGITPEDLRDAP
PF00270         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DFSQVARKIFDLVEDGIFVAHNVQFDANLLAENLFFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRE
PF00929         SFEEVLEEFLEFLKKGVLVAHNASFDVGLLAEDRRALNLPVLNPVIDTLILARKLLPGLPRRSLKALAKR
PF00270         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGIPLKHAHTALSDAQATAELLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00929         LGIELGRAHDALDDARATAELL------------------------------------------------
PF00270         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLIQAPTGIGKTYGY
PF00929         ----------------------------------------------------------------------
PF00270         --------------------------------------------------------LVAAPTGSGKTLAF


                         .         *         .         .         .         .         +:350
query           LLPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00929         ----------------------------------------------------------------------
PF00270         LLPILQALLETQALILAPTRELAEQIYERLKKLLKE----------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00929         ----------------------------------------------
PF00270         ----------------------------------------------