[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55344.1

[Show Plain Result]


## Summary of Sequence Search
    1::238
    4::213     6e-14  34%  215 aa  PF00119 ATP-synt_A "ATP synthase A chain"
    1::238

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNILEYVYDFVIGFTEPNIGS
PF00119         -----------------LNSLFMSLILLLILLLLFRLATRKLKLVPNRLQNLQEWLVEFVTNQVKDPIGG


                         .         .         *         .         .         .         .:140
query           RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
PF00119         KGHK-WAPLLLSLFLFILLSNLLGLLP---------YTFTPTTDLSVTLALALPLWLATVIYGLRNKGFF


                         +         .         .         .         .         *         .:210
query           KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
PF00119         GHLLPPGTPLPLIPLLVLIETISLLSLGVRLFANITAGQLISTALFVLIMPVVGLLPLLI--LLLLTILE


                         .         .         .         +         .         .         .:280
query           VFISCIQAYVFTLLTSVYLxxxxxxxxx
PF00119         LAVAFIQAYVFTLLTSLYL---------