[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55442.1

[Show Plain Result]


## Summary of Sequence Search
    1::160
    3::77      3e-12  47%   78 aa  PF01272 GreA_GreB "Transcription elongation factor, GreA/GreB,
   23::73      4e-10  61%   73 aa  PF03449 GreA_GreB_N "domain"
    1::160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
PF01272         ----------------------------------------------------------------------
PF03449         -------------------------VERPEIIEAIAEARELGDLSENAEYHAAKEEQGFIEGRIRELEKK


                         .         .         *         .         .         .         .:140
query           IRYAEIxxxxxxAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
PF01272         ------------SEDVVTFGATVTLEDLDDGEEETYTIVGPDEADPKKGVISPESPLGRALLGKKVGDEV
PF03449         LANAEI----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TIETPVGSYDVKILKVExxx
PF01272         EVNTPGGEKEYEILEVE---
PF03449         --------------------