[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55485.1

[Show Plain Result]


## Summary of Sequence Search
    1::347
   13::163     3e-11  32%  165 aa  PF00534 Glycos_transf_1 "Glycosyl transferases group 1"
    1::347

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00534         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00534         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVVGAGQVQKRKGIDDFIRLAEELPQITFIWAGGFSFGGM
PF00534         ------------------------------VILFVGRLTPQKGIDLLIEAFAKLPDVKLVIVGDGPYR--


                         .         .         .         +         .         .         .:280
query           TDGYEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLY
PF00534         ----EELEALAEELPDRVIFLGFVPDEELAELYAAADVFVLPSRYEGFGLVLLEAMACGLPVIASDVGGL


                         .         *         .         .         .         .         +:350
query           KVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00534         PEIVEGFLVDPGDPEALAEAILRLLEDPELRERMGEAA-----------------------------