[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55561.1

[Show Plain Result]


## Summary of Sequence Search
    1::321
   18::164     7e-18  42%  168 aa  PF00589 Phage_integrase "Phage integrase family"
    1::321

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00589         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00589         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxLRDLAIIDLLASTGMRVGELVQLNRSDIDFENRECVVFGKGKKERPV
PF00589         -----------------------LRDRALLLLLLLTGLRIGELLGLRWSDIDLENGTIRVRGKGGKSRTV


                         .         .         .         +         .         .         .:280
query           YFDARTKIHLRNYLNDRKDSHPALFVTLVGKAQRLGIAGVEIRLRKLGDKLGIQKVHPHKFRRTLATKAI
PF00589         PLPPELLEALREYLERRAAGDSDLFPSRRGKP--LSRRTVNRALKRAAKKAGLEKLTPHDLRHTFATHLL


                         .         *         .         .         .         .         +:350
query           DKGMPIEQVQKLLGHSKIDTTLAYAMVxxxxxxxxxxxxxx
PF00589         EAGVDLRVVQELLGHSSISTTQIYTHV--------------