[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55614.1

[Show Plain Result]


## Summary of Sequence Search
    1::226
    2::120     2e-20  39%  123 aa  PF04002 DUF2466 "Protein of unknown function (DUF2466)"
    1::226

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04002         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
PF04002         ---------------------------------ITSPEDVADYLRLELAGLEREVFRVLFLDTKNRLIAD


                         +         .         .         .         .         *         .:210
query           XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
PF04002         ETLFIGTLNSSIVHPREVFKRALKLNAAAIILAHNHPSGDPTPSQADIEITKRLKEAGKLLGIRLLDHII


                         .         .         .         +         .         .         .:280
query           VSHSNYFSYREKxxxx
PF04002         IGDGGYFSFAER----