[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55636.1

[Show Plain Result]


## Summary of Sequence Search
    1::232
    1::220     8e-11  32%  220 aa  PF09922 DUF2154 "Predicted membrane protein (DUF2154)"
    1::232

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxIFLFIEACLLTGALILMVSEHFSRXXXXXXXXXXXXRYYTGKEGNNLLLVAATILFFFIVMLNPF
PF09922         -----IFLLIGALLLLFALGLILDDGFLFLLLWPLILIAVGKSLKKRRLGGILLIIGLLLLLLGLFSNDF


                         .         .         *         .         .         .         .:140
query           VILAIFVAVIYSLFLLYPMMNQEKEQTNLVFXXXXXXXXXXNRWFGNLHHFSSYQTCQFDDINLFRFMGK
PF09922         FILAWAAFLIYGISLIFKKKKEKKEEKSLV---------DKNSWFGGVRRYDSYE---LEDINVQAGFGD


                         +         .         .         .         .         *         .:210
query           DTIHLERVILTNHDNVIILRKMVGTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYL
PF09922         VEIDLTDAILPEGETVIVIDAGFGGVKIYVPEDWEVSVEVSAIFGGVSFGELESVTYRSE-------DYD


                         .         .         .         +         .         .         .:280
query           KSNKSVKIFLTTMIGDVEVxxx
PF09922         EAEKKLKIIGSLGFGDVEV---