[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55668.1

[Show Plain Result]


## Summary of Sequence Search
    1::362
    6::361     1e-16  32%  364 aa  PF00465 Fe-ADH "Iron-containing alcohol dehydrogenase "
   19::295     4e-08  30%  312 aa  PF01761 DHQ_synthase "3-dehydroquinate synthase"
    1::362

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxGENALFENAKSILDLGNYPILLCDQLVYDIVGKRFEDYLHRYGFHIVLALFNGEASDN
PF00465         ------------GKGALAELGEELKNLGKRALIVTDGSLKKLLLDKVLDSLKAAGIEVVV--FDGVEPNP
PF01761         ---------------------------GRKVLIVTDENVAPLYGEKVRAALEAAGFEVVVVLPDGEAYKS


                         .         .         *         .         .         .         .:140
query           EINRVVALAEKENCDSIIGLGGGKTIDSAKAIADLIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYL
PF00465         TVETVVALAREFGADVIIAVGGGSVIDAAKAIALLAENPLIAIPTTAGTGSEVTPFAVITDEEGGRKYGL
PF01761         KIFDALLEAGLDRDDLIVALGGGVIGDLAGFAAATYMRPFIQVPTLAQVDSSVGGKTAINHPLGKNLIGA


                         +         .         .         .         .         *         .:210
query           FYSKNPDLVLVDTKVISQAPKRLLASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLF
PF00465         APALTPDVAILDPELTLTLPPRLTAATGMDALTHAIEAYVSTGANPIT----------DALALKAIKLIF
PF01761         FHQ--PKAVLIDTDFLKTLPERELRAGLAEGLIADWELFDWLEGNPYALLALRDPEALEELIERSIESKA


                         .         .         .         +         .         .         .:280
query           ADGLQAMAACEAKVVTPALENIVEANTXXXXXXXXXXXXXXXHAIHNGFTALTGDIHHLTHGEKVAYGTL
PF00465         EYLPRAVADGED---LEARENMLLASTLAGMAFANAGLG----AVH-ALAHPLGALFHIPHGEANAYARI
PF01761         A----VVAADEREGGLRALLNF-------------------GHTFGHAIEALTG-YGRWLHGEAVAIGMV


                         .         *         .         .         .         .         +:350
query           VQLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMPFKISPxxxxx
PF00465         ARALVDGGSDEEIEALRELFKSLGIPTTLSELGVDEEDIDEL----AEAALEDQCTGNNPRELTP-----
PF01761         LAARLSERSEEDVERIRALLKKAGLPTSLPDL--------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxx
PF00465         ------------
PF01761         ------------