[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55740.1

[Show Plain Result]


## Summary of Sequence Search
    1::185
    1::165     3e-43  61%  165 aa  PF01765 RRF "Ribosome recycling factor"
    1::185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
PF01765         ------------------ALKRELAKIRTGRANPSLLDGIRVEYYGSPTPLNQLAQVSVPDARTLSITPF


                         .         .         *         .         .         .         .:140
query           DKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
PF01765         DKSLVKAIEKAIRASDLGLNPQNDGTVIRVPIPPLTEERRKELVKVAKKEAEEAKVAVRNIRRDANDKLK


                         +         .         .         .         .         *         .:210
query           KQEKAKEITEDELKTLEKDIQKVTDDAVKHIDDMTANKEKELLxx
PF01765         KLEKDKEISEDDVKRLEKEVQKLTDKYIKKIDELLKAKEKELM--