[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55766.1

[Show Plain Result]


## Summary of Sequence Search
    1::532
    2::74      2e-08  39%   82 aa  PF06580 His_kinase "Histidine kinase"
   47::80      0.001  35%  101 aa  PF03091 CutA1 "CutA1 divalent ion tolerance protein"
    1::532

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06580         ----------------------------------------------------------------------
PF03091         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06580         ----------------------------------------------------------------------
PF03091         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06580         ----------------------------------------------------------------------
PF03091         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06580         ----------------------------------------------------------------------
PF03091         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQxxxxMRALQAQINPHFMYNTLEFLRMYAVM
PF06580         --------------------------------------------LKALQAQINPHFLFNTLNSISSLA-R
PF03091         ------EEDSEVLLLIKTTAELVDALEERIKELHPYEVPE------------------------------


                         .         .         .         .         *         .         .:420
query           QSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYxxxxxxxxxxxxxxxxxxxxxxx
PF06580         EDPEKAEEMILKLSDLLRYSLESGSELVLEEELEFIESYLELEKIRF-----------------------
PF03091         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06580         ----------------------------------------------------------------------
PF03091         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06580         ------------------------------------------
PF03091         ------------------------------------------