[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55904.1

[Show Plain Result]


## Summary of Sequence Search
    1::474
    9::435     3e-75  42%  440 aa  PF00171 Aldedh "Aldehyde dehydrogenase family"
    1::474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxEELGTVPAMTQTEXXXXXXXXXXXXXXXXXXXXIERAAYLHKT
PF00171         ---------------------------EVLAEVPAATAADVDAAVAAARAAFRAWAALSAEERAAILRAI


                         .         .         *         .         .         .         .:140
query           AAILERDKEKIGTILAKEVAKGIKAAIGEVVRTADLIRYAAEEGXRITGQAMEGGGFEAASKNKLAVVRR
PF00171         ADLLEANRDELAAAATLETGKPLAEAKGEVARAADFLRYYAGLARRLAGEVLEDPGLRIR-------VRR


                         +         .         .         .         .         *         .:210
query           EPVGIVLAIAPFNYPVNLSASKIAPALIAGNVVMFKPPTQGSISGLLLAKAFEEAGIPAGVFNTITGRGS
PF00171         EPLGVVGVITPWNFPLAVAAWKAAPALAAGNAVVLKPSEETPLSALALAELLREAGLPAGVVNLVPGPGA


                         .         .         .         +         .         .         .:280
query           EIGDYIIEHKEVNFINFTGSTPIGERIGRLAGMRPIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSG
PF00171         EVGDALVAHPDVDLVSFTGSTAVGRAIMRAANLKPVTLELGGKNPVIVDEDADLDKAVEGIVNSKFFNAG


                         .         *         .         .         .         .         +:350
query           QRCTAIKRVIVLESVADKLATLLQEEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTP
PF00171         QVCTAPERLLVHESIADEFLEALAAALAALKVGDPLDDTDLGPLISAAQFDRVEALIDDAVAEGAKVLAA


                         .         .         .         .         *         .         .:420
query           IKREGNLLWPVLFDQVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIA
PF00171         DDEKGYFVEPTVLADVTPDMRIAQEEIFGPVLPVVRFDDEDEAIALANDTEYGLTASVFTRDLARAERVA


                         .         .         +         .         .         .         .:490
query           EKLEVGTVHINNKTQRGPDNFPFLGVKGSGAGVQGxxxxxxxxxxxxxxxxxxx
PF00171         RRLEAGRVWINDPT-TGAAVAPFGGVKQSGIGREG-------------------