[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF55996.1

[Show Plain Result]


## Summary of Sequence Search
    1::798
    7::76      3e-06  39%   76 aa  PF00271 Helicase_C "Helicase conserved C-terminal domain"
   18::128     1e-05  35%  167 aa  PF00270 DEAD "DEAD/DEAH box helicase"
    3::73      3e-05  32%  177 aa  PF04851 ResIII "Type III restriction enzyme, res subunit"
    1::798

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00271         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00271         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00271         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxELNPEQRQARDAVVSSIGSS
PF00271         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         --------------------------------------------------KLRPYQKEAIEALLEAIEEG


                         .         *         .         .         .         .         +:350
query           QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKY
PF00271         ----------------------------------------------------------------------
PF00270         ----LVAAPTGSGKTLAFLQALLETLKNGPQALILAPTRELAEQIYERLLKEPGLRVGLLVGGVS----I
PF04851         KKRGLIEGPTGTGKTFTMAKLIAARLYGFKKVLVLAPSKTLVDQLYEEF---------------------


                         .         .         .         .         *         .         .:420
query           DEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00271         ----------------------------------------------------------------------
PF00270         EEQLRVLRKGVDIVVGTPGRLLLNLSNLRLLVLDE-----------------------------------
PF04851         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00271         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00271         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxRILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTA
PF00271         -------------RVARLHGDLSQEE--REEILERFRRGEVKVLVATDVAERGLDIPDVDLV------ID
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LNLPDFRSSERTFQLLTQVAGRAGRAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00271         FDLPWSPAS------YIQRIGRAGRAQ-------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00271         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00271         ----------------------------
PF00270         ----------------------------
PF04851         ----------------------------