[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56022.1

[Show Plain Result]


## Summary of Sequence Search
    1::424
    7::262     9e-68  70%  263 aa  PF09903 DUF2130 "Uncharacterized protein conserved in bacteria
  579::734     2e-05  20% 1179 aa  PF12128 DUF3584 "Protein of unknown function (DUF3584)"
   11::148     2e-04  25%  259 aa  PF00529 HlyD "HlyD family secretion protein"
   73::168     8e-04  32%  194 aa  PF04156 IncA "IncA protein"
    1::424

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxFTVNESQYAELLSQVRTTEFDKELHDRMRQELALAEQKAMNEQQTKLAQKDQEIAQLQ
PF09903         ----------------------------------------------------------------------
PF12128         ------------YAASEEELRERLAQIEAALQSAQEEQEELEKQLKAINKEIKELKREITEAEYELEQAR
PF00529         ---------------------------RVTEILVKEGDRVKKGQVLARLDP-TDYQAALAQAEAQLAAAQ
PF04156         --------------------------------------------SLEQQGKLSEEEQPLAQLRKELSQLQ


                         .         .         *         .         .         .         .:140
query           SQIQNFDTEKELAKKEVEQTSHQALLAKDKEVQALENQLATLRLEHENQLQKTLSDLEKERNQVXXXXXX
PF09903         ----------------------------------------------------------------------
PF12128         DDLKRLKNELEELKKKAEEAKEERKQELEEQLNALEAELKQLKEELEELLEEQKEQLNELRNEKKAQWQE
PF00529         AQARLAAAQLERAQALVAQAAAASQQALDAAQAALQQALAAVQAAAQAQLDQARANLEYA--QATAPAAG
PF04156         EWLAELLKELEDLKEDVYQLLEQRLLSLGREVEKLEEELRELRSRLRKKLDRLQCEVDKLRKEV------


                         +         .         .         .         .         *         .:210
query           XXXXXXXSLASVKQNYEAQLKAASEQVEFYKNFKAQQSTKAIGESLEQYAESEFNKVRSFAFPNAYFEKD
PF09903         -----------LKKEYEEQLKDLQEQIEELKRRKEQGSTKLQGEELEQWCEEEF--VLAYAFPNDYFEKD
PF12128         LEGELDNQLEQIKAEIEAERQEAKERLK------------------------------------------
PF00529         RIGAAQATLGALVSALQAQVLAAQAQLD------------------------------------------
PF04156         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NKVSSRGSKGDFIFRECDENGVEIISIMFEMKNEADGTEKKHKNADFYKELDKDRREKNCEYAVLVTMLE
PF09903         NK-GVRGAKGDFIFRVFDENGQEIGSIMFEMKNESDDTRTKHKNEDFLKKLDKDRREKKCEYAVLVSELE
PF12128         ----------------------------------------------------------------------
PF00529         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ADNDYFNTGIVDVSHEYEKMYVVRPQFFIQLIGLLRNAALNSLKYKQELALVREQNIDITHFEEDLDAFK
PF09903         PDN----TGIVDVSHEYEKMYVVRPQFFIPLITLLRNAAIKSLKYKQELENVKEKNIDITNFEEEFKQFK
PF12128         ----------------------------------------------------------------------
PF00529         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LAFAKNYNSASTNFGKAIDEIDKAIKRMEEVKKFLTTSENQLRLANNKLEDVSVKKLTRKNPTMxxxxxx
PF09903         EAFAKNYNSASEKFEKEIDEIDKSIKKREKQKEALLTSENNLRLANNKIAGLSIKKLTRLNPTL------
PF12128         ----------------------------------------------------------------------
PF00529         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxx
PF09903         ----
PF12128         ----
PF00529         ----
PF04156         ----