[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56069.1

[Show Plain Result]


## Summary of Sequence Search
    1::335
    2::279     2e-64  52%  282 aa  PF00365 PFK "Phosphofructokinase"
    1::335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
PF00365         --RIGILTSGGDAPGLNAVIRGVVRTAIYYGVEVYGIRDGYEGLLEGDIIELTWEDVSGILNRGGTILGS


                         .         .         *         .         .         .         .:140
query           ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
PF00365         SRYKPFKDEEGREKAAENLKKLGIDALVVIGGDGSLTGAAKLAEYKIPVVGVPKTIDNDLPGTDYTFGFD


                         +         .         .         .         .         *         .:210
query           TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYE
PF00365         TAVKTATEAIDRLRTTASSHNRVFVVEVMGRHAGWLALAAGLAGGADVILIPEIPFDIDKLCEKIKERRK


                         .         .         .         +         .         .         .:280
query           CGKKHNIIVLAEGVMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKxxxxxx
PF00365         RGKRFAIIVVAEGAKGTAELAKEIEEERGF-ETRVTVLGHLQRGGSPSAFDRVLATRFGAKAVE------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00365         -------------------------------------------------------