[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56071.1

[Show Plain Result]


## Summary of Sequence Search
    1::66
    8::67      6e-04  28%   70 aa  PF00137 ATP-synt_C "ATP synthase subunit C"
    1::66

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIx
PF00137         -----LAVGLAALGAGIGIGIAGGAAIEAVARQPELAGKLFTKMIIGLAFAEALGLYGLVVALLL-