[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56087.1

[Show Plain Result]


## Summary of Sequence Search
    1::292
    5::159     7e-43  59%  160 aa  PF03193 DUF258 "Protein of unknown function, DUF258"
  102::166     5e-04  38%  305 aa  PF11602 NTPase_P4 "ATPase P4 of dsRNA bacteriophage phi-12"
    1::292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03193         ----------------------------------------------------------------------
PF11602         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQTYGDIGYDFVTSK
PF03193         --------------------------------------------------------EVYRAIGYDFVSAK
PF11602         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGF
PF03193         DELKEALKGKTTVLVGQSGVGKSTLINALLPDLELKTGEISESLGRGRHTTTHVELYPLGGGLLIDTPGF
PF11602         ----------VTVVVGKTGSGKSETLNGKDPDVTIRWGEPLE----GYDTDTAVAVSDLDEVAL----GL


                         .         .         .         +         .         .         .:280
query           SSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLxxxxxxx
PF03193         REFGLWHLDPEELADAFPEFRELAGDCKFRDCTHLHEPGCAVKEAVEEGKISEERYDSYLKLL-------
PF11602         AALDFRVIVVDSL---------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxx
PF03193         ------------
PF11602         ------------