[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56119.1

[Show Plain Result]


## Summary of Sequence Search
    1::109
    1::114     6e-06  41%  115 aa  PF02537 CRCB "CrcB-like protein"
    1::109

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTT
PF02537         --LLLVALGGILGALARYGLSLLYLGGAFPLGTLWVNVLGSFLLGLLASGKLSPPLYLGLGTGFCGGFTT


                         .         .         *         .         .         .         .:140
query           FSTLNDELQRLLSDKKVFYSYLTLTYIGGLVAIFLGIxx
PF02537         FSTFSLETFLLLRNGRLALLYVLLSVGLGLLAAALGL--