[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56127.1

[Show Plain Result]


## Summary of Sequence Search
    1::555
    1::169     1e-24  46%  173 aa  PF02734 Dak2 "DAK2 domain"
    1::555

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVPDGDTGTNMGMTIENGAKEVADKPASTVGEVASIL
PF02734         ----------------------------------VGDGDTGTNMARGFRAALEALDDLPLADIGEVLKAI


                         .         .         *         .         .         .         .:140
query           AKGLLMGARGNSGVITSQLFRGFSQAIKDKDELTGQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAI
PF02734         AMALLSGAGGNSGVLLGQFFRGAAKALKGKEELTAADLAAALQAALD-AVQAVAKPGDKTMLDVLRPAA-


                         +         .         .         .         .         *         .:210
query           GAKKKAEQTDDTVEVMRAALEGAKTALAKTPDMLPVLKEVGVVDSGGQGLVFIYExxxxxxxxxxxxxxx
PF02734         EALEEAKDGEDLAEALEAAAEAAEAGAESTKDMLAVLRSLGVVDPGAVGLALILE---------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         -----------------------------------------------------------------